KEGG   Vibrio vulnificus MO6-24/O: VVMO6_04138Help
Entry
VVMO6_04138       CDS       T01415                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00230  Purine metabolism
vvm00250  Alanine, aspartate and glutamate metabolism
vvm01100  Metabolic pathways
Module
vvm_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VVMO6_04138
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    VVMO6_04138
Enzymes [BR:vvm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     VVMO6_04138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADV89160
Position
II:1329362..1330618
Genome map
AA seq 418 aa AA seqDB search
MTSIVVVGANWGDEGKGRIVDFLAENAAASVRFQGGNNAGHTVVNHFGTFKLHQLPSGVF
NPGCLAVLGPGMVISPALLSQELAEVEQSGVKVNLCISDRATLCLPLHALEDTLEEQRLG
DKAYGSTRQGIAPAYGDRVMKKGILLGWLKQPEVLVERLQFMLDWKLPQLRALYPEFKFE
QTAQEMADWLLEVSAPWRDAICNVSVPLKALQAEKQNLLFEAQLGAGRDLVYGEYPWTTS
SNVVSAYAGIGSGLPALRPERVIAVAKAFSSSVGTGTLITAMEEQDAFREAANEFGATTG
RPRDMGYFDAVATQNGVELQAATEIALTKLDCLTGLDDLKICVAYQGDHSENPIWPQTAA
LAPVYEKMPSWSEDITACRRFEDLPQAAQQYVLRIEELMGVPVSMVSVGPGREQMILR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgacgtctatcgttgttgtgggtgcaaactggggtgatgaaggcaaaggccgcatcgtt
gattttctagcagaaaacgcagcggctagcgtacgtttccaaggaggaaacaacgcaggt
cataccgtagtgaaccattttggtacattcaaacttcatcaactgcctagtggtgtcttc
aacccaggttgcctcgcggtgcttggccctggcatggtaattagcccagctctgctttct
caggaattggcggaagttgaacaatctggcgtgaaagtgaatctgtgtatttctgatcgt
gcaacgctgtgtctaccgcttcacgcactagaagataccctagaagaacagcgcctaggc
gacaaggcttacggttccactcgccaaggtattgctcctgcttacggtgatcgcgtgatg
aaaaaaggcattctgctaggctggctaaaacaacctgaagtattggtcgagcgtctgcaa
tttatgttggattggaaactgccacaactacgtgcactctaccctgagttcaagtttgaa
caaacggcgcaagagatggccgattggctacttgaggtatctgccccttggcgtgatgcg
atttgtaacgtgtccgtccctctcaaagcactgcaagcggaaaagcaaaacctacttttt
gaagcgcaactgggtgctggccgtgatctcgtctatggtgaatacccttggacaacctct
tccaacgtggtttctgcgtacgcaggcattggcagtggtttaccagcccttcgcccagag
cgcgttatcgctgtcgctaaagccttcagctcatctgttggtacaggtacgctgatcaca
gcaatggaagaacaagacgccttccgtgaagcggcgaacgagttcggtgcaacaaccggt
cgccctcgcgatatgggctactttgatgccgtagccacccaaaatggggttgagctacaa
gcggcaaccgagatcgctctaaccaaactggattgtttgactggccttgacgatctgaaa
atctgtgtggcttaccaaggcgatcacagtgagaacccaatttggcctcaaaccgcagca
ttagcaccagtttacgagaaaatgccaagctggagcgaagacatcaccgcctgccgtcgt
tttgaagatctgcctcaagccgctcagcaatatgtgttgcgcattgaagaactgatgggc
gttccagtaagtatggtctctgttggccctggtcgtgagcaaatgatcctacgttaa

DBGET integrated database retrieval system