KEGG   Vulpes vulpes (red fox): 112907546Help
Entry
112907546         CDS       T05911                                 

Gene name
PPIL2
Definition
(RefSeq) RING-type E3 ubiquitin-protein ligase PPIL2
  KO
K10598  peptidyl-prolyl cis-trans isomerase-like 2 [EC:5.2.1.8]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112907546 (PPIL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vvp03041]
    112907546 (PPIL2)
   03110 Chaperones and folding catalysts [BR:vvp03110]
    112907546 (PPIL2)
   04121 Ubiquitin system [BR:vvp04121]
    112907546 (PPIL2)
Enzymes [BR:vvp01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     112907546 (PPIL2)
Spliceosome [BR:vvp03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    112907546 (PPIL2)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    112907546 (PPIL2)
Chaperones and folding catalysts [BR:vvp03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    112907546 (PPIL2)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  U-box type E3
   112907546 (PPIL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase Rtf2 zf-NOSIP U-box Ribosomal_S6
Motif
Other DBs
NCBI-GeneID: 112907546
NCBI-ProteinID: XP_025838553
UniProt: A0A3Q7QWL7
Position
Unknown
AA seq 523 aa AA seqDB search
MGKRQHQKDKMYITCAEYTHFYGGKKPDIPQANFRRLPFDHCSLSLQPFAYPVCTPEGIV
FDLLNIVPWLKKYGTNPSNGEKLDGRSLIKLNFAKNKEGKYHCPVLFTVFTNNTHIVAIR
TTGNVYTYEAVEQLNIKAKNFRDLLTDEPFSRQDIITLQDPTNLDKFNVSNFFHVKNNIK
IIDPDEEKAKQDPSYYLKNTNTETRETLQELYKEFKGDEVLAATMRVPEKKKVDKLNAAH
YSTGKVSASFTSTAMVPETTHEAAAIDEDVLRYQFVKKKGYVRLHTNKGDLNLELHCDMT
PKTCENFIKLCKKQYYDGTIFHRSIRNFVIQGGDPTGTGTGGESYWGKPFKDEFRPNLSH
TGRGVLSMANSGPNANKSQFFITFRSCAYLDKKHTIFGRVVGGFDTLTAMENVESDPKTD
RPKEEIRIDSTTVFVDPYEEADAQIAEERKRTQLEEAAAPESTVKTRQPKPGSQGPQTYR
QGVGKYINPAATKRVAEEEPSTSTAVPVAKKKPSRGFGDFSSW
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggggaagcgacagcatcagaaggacaagatgtacattacctgtgctgaatatactcac
ttctatggtggcaagaaaccagatatcccacaagcaaattttcgtcgtttaccttttgat
cactgcagtctctctctgcagccctttgcctacccggtctgcacccctgaaggcatcgtc
tttgacttgcttaacatcgtcccttggcttaagaagtatgggaccaaccccagcaacgga
gagaaactggatgggaggtccctgatcaagctgaactttgcaaagaacaaggaaggaaag
taccactgcccagtgctgttcactgtattcaccaacaacacccacatcgtagccatcagg
accaccggcaacgtgtacacctatgaggcagtggagcaactaaatatcaaggccaagaac
ttccgagacctgctgacagatgagcccttctctcggcaggatatcatcaccctccaggac
cccaccaatttggacaaattcaatgtctccaacttctttcacgttaagaataacataaaa
ataatagatcccgatgaagagaaggcgaaacaggacccgtcttattatttgaaaaataca
aacaccgagacccgagagacactgcaggagctctacaaggagttcaaaggggacgaggtc
ctggcggccaccatgagagtcccggagaagaagaaagtggacaagctgaacgctgcacac
tattccaccgggaaggttagcgcctccttcacatccaccgccatggttccagagaccaca
catgaagcagctgccattgatgaggacgtgctgcgataccagtttgtgaagaagaagggc
tacgtgcggcttcacaccaacaagggcgacctcaacctggagctgcactgcgacatgacg
ccaaagacctgtgagaacttcatcaagctctgcaagaagcagtattacgatggcaccatc
ttccacagatccatcaggaactttgtgatccaggggggtgaccccaccggcacagggaca
ggcggggagtcatactggggaaagcccttcaaagatgagttccggcccaatctctcgcac
acgggccggggcgtcctcagcatggccaactcgggacccaacgccaacaagtctcagttc
tttatcaccttccgctcctgcgcgtacctcgacaagaagcacaccatcttcgggcgggtt
gtcgggggctttgacacactgacagccatggagaatgtggagagtgaccccaaaactgac
cgccctaaggaggagatccgcatcgactccaccaccgtgtttgtggacccatacgaggag
gctgacgctcagattgccgaggagcggaagaggacacagcttgaggaggcagcggccccg
gaaagcacagtgaaaacccgccagcccaagccggggagccaggggccccagacataccgc
cagggggtgggcaagtacatcaacccagcagccacgaaacgtgtagcagaggaagagccc
tcaaccagtacagctgtgcctgtggccaagaagaagcccagccgaggctttggggacttc
agctcatggtag

DBGET integrated database retrieval system