KEGG   Vulpes vulpes (red fox): 112914338Help
Entry
112914338         CDS       T05911                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04218  Cellular senescence
vvp04350  TGF-beta signaling pathway
vvp04380  Osteoclast differentiation
vvp04390  Hippo signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05140  Leishmaniasis
vvp05142  Chagas disease (American trypanosomiasis)
vvp05144  Malaria
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05321  Inflammatory bowel disease (IBD)
vvp05323  Rheumatoid arthritis
vvp05410  Hypertrophic cardiomyopathy (HCM)
vvp05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112914338 (TGFB2)
   04350 TGF-beta signaling pathway
    112914338 (TGFB2)
   04390 Hippo signaling pathway
    112914338 (TGFB2)
   04068 FoxO signaling pathway
    112914338 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112914338 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112914338 (TGFB2)
   04218 Cellular senescence
    112914338 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112914338 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914338 (TGFB2)
   05206 MicroRNAs in cancer
    112914338 (TGFB2)
   05205 Proteoglycans in cancer
    112914338 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112914338 (TGFB2)
   05212 Pancreatic cancer
    112914338 (TGFB2)
   05225 Hepatocellular carcinoma
    112914338 (TGFB2)
   05226 Gastric cancer
    112914338 (TGFB2)
   05220 Chronic myeloid leukemia
    112914338 (TGFB2)
   05211 Renal cell carcinoma
    112914338 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112914338 (TGFB2)
   05321 Inflammatory bowel disease (IBD)
    112914338 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    112914338 (TGFB2)
   05414 Dilated cardiomyopathy (DCM)
    112914338 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112914338 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112914338 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112914338 (TGFB2)
   05161 Hepatitis B
    112914338 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112914338 (TGFB2)
   05144 Malaria
    112914338 (TGFB2)
   05145 Toxoplasmosis
    112914338 (TGFB2)
   05140 Leishmaniasis
    112914338 (TGFB2)
   05142 Chagas disease (American trypanosomiasis)
    112914338 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112914338 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112914338 (TGFB2)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112914338 (TGFB2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   112914338 (TGFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 112914338
NCBI-ProteinID: XP_025847095
UniProt: A0A3Q7SXC4
Position
Unknown
AA seq 442 aa AA seqDB search
MHYCVLSAFLILHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSFCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctgcaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtctacaagatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttctgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgtccgattt
gacgtctcggcgatggagaagaatgcatccaacttggtgaaagcagagttcagagtcttt
cgtttacagaacccgaaagccagagtgcccgaacagcggatcgaactgtatcagattctc
aaatccaaagatttaacgtctccaacccagcgctacattgacagcaaagtcgtcaagacg
agagcagaaggcgaatggctttcctttgacgtgaccgacgccgtccatgaatggctccac
cataaagacagaaacctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatctaataattacatcattcccaataaaagtgaagagctagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgttttagaaat
gtgcaggataattgctgtctacgtccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgaacctaaagggtacaatgccaacttctgtgctggagcatgcccatat
ttatggagttcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcatctgcctccccttgctgcgtgtcccaggatttagaaccgctaaccattctctac
tacatcggcaaaacacccaagattgaacagctctccaatatgatcgtaaagtcttgcaaa
tgcagctaa

DBGET integrated database retrieval system