KEGG   Vulpes vulpes (red fox): 112918276Help
Entry
112918276         CDS       T05911                                 

Gene name
GSTM3
Definition
(RefSeq) glutathione S-transferase Mu 3 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00480  Glutathione metabolism
vvp00980  Metabolism of xenobiotics by cytochrome P450
vvp00982  Drug metabolism - cytochrome P450
vvp00983  Drug metabolism - other enzymes
vvp01100  Metabolic pathways
vvp01524  Platinum drug resistance
vvp05200  Pathways in cancer
vvp05204  Chemical carcinogenesis
vvp05225  Hepatocellular carcinoma
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112918276 (GSTM3)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112918276 (GSTM3)
   00982 Drug metabolism - cytochrome P450
    112918276 (GSTM3)
   00983 Drug metabolism - other enzymes
    112918276 (GSTM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112918276 (GSTM3)
   05204 Chemical carcinogenesis
    112918276 (GSTM3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112918276 (GSTM3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112918276 (GSTM3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112918276 (GSTM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvp02000]
    112918276 (GSTM3)
Enzymes [BR:vvp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112918276 (GSTM3)
Transporters [BR:vvp02000]
 Other transporters
  Pores ion channels [TC:1]
   112918276 (GSTM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C GST_C_3 GST_N GST_N_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-GeneID: 112918276
NCBI-ProteinID: XP_025852170
UniProt: A0A3Q7TAQ6
Position
Unknown
AA seq 203 aa AA seqDB search
MLLEFTDTCYEERRYTCGEAPDYDKSQWLDVKFKLDLDFPNLPYLMDGKNKITQSNAILR
YIARKHNMCGETEEERIRVDIMENQIMDFRIQLVQLCYSPDLEKLKPRYLEQLPGQLKQF
SLFLGKFSWFAGEKLTFVDFLTYDVLDQNRMFEPKCLDEFPNLKAFMCRFEALEKIANYM
QSDRFLKMPINNKMALWGNKRIC
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggagttcacggatacctgctatgaggagagacggtacacgtgcggggaagct
ccggactatgataaaagccaatggctggatgtgaaattcaagctcgacctggactttcct
aacctgccctacctcatggatggtaagaacaagatcacccagagtaatgctatcctgcgc
tacatcgctcgcaagcacaatatgtgtggtgagactgaagaagaaagaattcgagtggac
atcatggagaaccaaataatggatttccgcatacagctggtacaactgtgctacagtcct
gaccttgaaaaactgaagccccggtacttggaacagctacctggacaactgaaacagttc
tccttgttcctggggaaattctcctggtttgcaggagaaaagctcacctttgtggatttc
ctcacttatgatgtcttggatcagaaccgtatgtttgagcccaagtgcctggatgaattt
ccaaatctgaaggctttcatgtgccgttttgaggctttggagaagatagctaactacatg
cagtctgaccgcttcctgaagatgcccatcaacaacaagatggccctgtggggcaacaag
agaatatgctga

DBGET integrated database retrieval system