KEGG   Vulpes vulpes (red fox): 112919809Help
Entry
112919809         CDS       T05911                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00564  Glycerophospholipid metabolism
vvp00565  Ether lipid metabolism
vvp00590  Arachidonic acid metabolism
vvp00591  Linoleic acid metabolism
vvp00592  alpha-Linolenic acid metabolism
vvp01100  Metabolic pathways
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04217  Necroptosis
vvp04270  Vascular smooth muscle contraction
vvp04370  VEGF signaling pathway
vvp04611  Platelet activation
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04724  Glutamatergic synapse
vvp04726  Serotonergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04912  GnRH signaling pathway
vvp04913  Ovarian steroidogenesis
vvp04921  Oxytocin signaling pathway
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    112919809 (PLA2G4D)
   00565 Ether lipid metabolism
    112919809 (PLA2G4D)
   00590 Arachidonic acid metabolism
    112919809 (PLA2G4D)
   00591 Linoleic acid metabolism
    112919809 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    112919809 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112919809 (PLA2G4D)
   04010 MAPK signaling pathway
    112919809 (PLA2G4D)
   04370 VEGF signaling pathway
    112919809 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    112919809 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112919809 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112919809 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    112919809 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    112919809 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    112919809 (PLA2G4D)
   04913 Ovarian steroidogenesis
    112919809 (PLA2G4D)
   04921 Oxytocin signaling pathway
    112919809 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112919809 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    112919809 (PLA2G4D)
   04726 Serotonergic synapse
    112919809 (PLA2G4D)
   04730 Long-term depression
    112919809 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112919809 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    112919809 (PLA2G4D)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     112919809 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 112919809
NCBI-ProteinID: XP_025854112
UniProt: A0A3Q7T2D7
Position
Unknown
AA seq 817 aa AA seqDB search
MERLTTRGPPGHPHQGEASACWQLTVRVLEARNLGWTDLLSQADPYVTLQLPTTPGTKFK
TKTITNSSHPVWNETFSFLIQSQVKNVLELNVYDEDSVTEDDACFKVLYDVSEVQPGELL
RKTFSLRPQGQEELDVEFLLEKTSDCPENLITNNVLVARELSCLDVRLDSAESTAQVTDE
EQLKLELVLKGSYEDTQTSALGTASAFCFHYLAAQETELSVQLRSSESNDWNSDKSAGHL
TVPLRSLAMGKEVTVNVPVINTPGVRLQLKAEGCPKELAVRLGYDLCAEEKAFLSRRKRV
VARALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALKKLGLLDCVTYFSGI
SGSTWAMAHLYGDPEWSQKDLEGPIKYAREHLAKSKLEAFSPERLASYRQELELRAKQGY
PTTFVDLWALVLESMLHGQVMDQKLSEQRAALEQGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFPKYGAFVPTELFGSEFFMGRLMRRLPESRICFLEGIWSNIFSLNLLDAWY
DLTNSGDTWKQHIKDKIRNLEESPASLTTSSWLEASWMEPGTALAKAFKGFLTSRPLHQH
SCNFLRGLQLHQDYCSHKDFSTWADCQLDSTPGQLTPQEPWLCLVDVGYFLNTSCPSMFR
PGRRLDLILSLDYSLSAPFEALQQTELYCRARGLPFPRVDPSPQDQRQPTECHLFSDPTC
PDAPVLLHFPLVNASFKDHSAPGVQRSPAELPASQVDLTGTTSPYYLFNMTYKEEDFDHL
LQLSDYNVRNSQDAILQALRTAMEHRALGTRPPTVRN
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactgacaactaggggaccacctggccatcctcaccagggggaggcctctgcc
tgctggcagctcactgtgagggtcctggaggcacggaacctgggctggactgacctgttg
agccaggcagacccctatgtgaccctgcagttgccaaccacacctggaacaaagttcaag
accaaaacgatcaccaactccagccatcctgtatggaatgagaccttcagtttcctaatc
cagagtcaggtcaagaatgttctggagctaaatgtctatgatgaggactcagtcacggag
gatgatgcctgcttcaaggttctctatgacgtctcagaagtccagccaggtgagctgctc
cggaagaccttctccctgcgtccccagggacaggaggagctggacgtggagttcttgctg
gaaaaaacgtcagactgcccagaaaacctcatcaccaacaacgtccttgtggcccgagag
ctgtcatgcctggatgtccgtctggacagtgccgagagcacagcccaggtcacagatgag
gagcagctgaagctggagctggtgctgaaggggtcatatgaggacacgcagacatctgcc
ctgggtacggcctctgccttctgcttccattacctggcagcccaagagacagaactgagt
gtgcagctgaggagctctgaaagcaatgactggaattcagacaagtcagctgggcacctc
actgtgcccctgaggtccttggccatggggaaggaggtgactgttaacgttcctgttata
aataccccaggagtgaggctgcagctcaaggctgagggctgccctaaggagctggctgtg
cgcctgggctatgatttgtgtgccgaggagaaagctttcctgagcaggaggaaacgggtg
gtggccagagccctcaagcaggccctgcagctggacagagacctacaggaagatgaggtc
cctgttgtgggcatcatggccacaggaggaggtgcccgggccatgacctctctctacggc
cacctgttggccctgaagaagctgggcctcctggactgtgtgacctacttcagtggcatc
tcaggctctacatgggccatggcccacctctacggggaccctgagtggtcacagaaggac
cttgaaggacccatcaaatatgccagggagcacctggccaagagcaagctggaggccttc
tccccagagcgcctagcaagctaccgccaggagctggagctgcgggccaagcagggctac
cccacaacttttgtggacctgtgggctctcgtgctggagtctatgctacacggccaggtg
atggatcagaagctgtcggaacagagagcagcactggagcagggccagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagaccctcgacttcaaggagtgg
gtggagttctccccctatgaggtcgggttcccgaagtatggagcctttgtcccgacggag
ctctttggctccgagttcttcatggggcggctgatgaggaggctcccggagtcccgcatc
tgctttctggaaggtatctggagcaacattttctccctgaacttgctggatgcctggtac
gacctcaccaactctggtgacacctggaagcagcacatcaaggacaagatcaggaacctg
gaggagtctcctgcctccttgacgacatcctcatggctggaggcctcatggatggaacct
ggaacggccctggccaaggcatttaagggcttcctgacaagcaggccactccaccagcac
agctgcaacttcctccggggcctccaactgcaccaggattattgtagccacaaagatttc
tccacttgggcagactgccagctagactccacccctggtcagctgacccctcaggagccc
tggctctgcctggtagatgttggctacttcctcaacactagctgtccctccatgttccgg
ccaggccgaaggctggacctcatactctccttggattactccctctccgcaccctttgag
gccctgcagcagactgagctatactgccgggcccggggactgccattccctcgagtggac
cccagccctcaggaccaacgccagccgacagagtgccacctcttctcggaccccacctgc
cctgatgcccctgtcctgctgcacttcccgctggtcaacgcctccttcaaggaccactca
gcccccggtgtccagcgcagccccgcagagctcccagccagccaggtggatctcactggg
accacctcaccctactacctgttcaacatgacctataaggaggaggactttgatcatcta
ctgcagcttagtgactacaatgtacggaacagccaggacgccattctgcaggccttgagg
actgccatggagcaccgggccctgggcaccaggcctccaacagtgaggaattga

DBGET integrated database retrieval system