KEGG   Vulpes vulpes (red fox): 112919984Help
Entry
112919984         CDS       T05911                                 

Gene name
CD38
Definition
(RefSeq) ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1
  KO
K01242  ADP-ribosyl cyclase 1 [EC:3.2.2.6 2.4.99.20]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00760  Nicotinate and nicotinamide metabolism
vvp01100  Metabolic pathways
vvp04020  Calcium signaling pathway
vvp04640  Hematopoietic cell lineage
vvp04921  Oxytocin signaling pathway
vvp04970  Salivary secretion
vvp04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    112919984 (CD38)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    112919984 (CD38)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112919984 (CD38)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112919984 (CD38)
  09154 Digestive system
   04970 Salivary secretion
    112919984 (CD38)
   04972 Pancreatic secretion
    112919984 (CD38)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:vvp04090]
    112919984 (CD38)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112919984 (CD38)
Enzymes [BR:vvp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.20  2'-phospho-ADP-ribosyl cyclase/2'-phospho-cyclic-ADP-ribose transferase
     112919984 (CD38)
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.6  ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase
     112919984 (CD38)
CD molecules [BR:vvp04090]
 Proteins
  112919984 (CD38)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Hyaluronan
  Cell surface receptors
   112919984 (CD38)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_hydrolayse
Motif
Other DBs
NCBI-GeneID: 112919984
NCBI-ProteinID: XP_025854327
UniProt: A0A3Q7T2Y7
Position
Unknown
AA seq 308 aa AA seqDB search
MANHRFSSVSEEEKPCCGISRKAQICLCVLFVLLIVVGIAVSVGILMWRQPPKHKEWKGP
GTTAHFYEILLGRCYTYTQIVRPELRHTDCQKIGKAFTSAFLSKDPCGSTEQDYRPLMEL
TTQTVPCDKTLFWSKSSELAHDYTWVQRDMYTLEDTLLGYMADGLKWCGDAGSSEMNYQS
CPHWREDCSNNSVSVFWNTVSKRFAEDACGVVHVVLNGSISNTFDEKSTFGRVEVFNLHP
EKVHTLKAWVMNNIESVPSDSCSSSSVNNLKQILKTRNITFVCQNNYRPVRLIQCVKNPE
HSSCRYNL
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggccaaccacaggttcagttccgtgtccgaggaggagaaaccctgctgcggcatttcc
agaaaagcccagatctgtctctgcgtcctttttgttctcctgattgtggtgggcatcgcc
gtgtcggtcgggatcctgatgtggcgccagccgcccaagcacaaggagtggaaggggccg
ggcaccactgcccatttttacgagatcctcctgggacggtgctacacgtacactcaaatc
gtgcgacctgagctgcgacatacagactgccaaaagatagggaaggcattcacaagtgca
tttctttcgaaggacccttgtggcagtacagaacaggactatcggccactaatggaactg
acaactcaaactgtaccttgtgacaagaccctcttttggagcaaatcaagtgagctggcg
catgactacacgtgggtccagcgggatatgtacaccctggaggatacactgttgggttac
atggcggatggcctcaagtggtgtggagacgcaggctcttctgaaatgaactatcaatct
tgtccacactggagggaagactgcagcaataactctgtttccgtattctggaacacagtg
tccaaaaggtttgcagaagatgcctgtggtgtggtccatgtggtgctcaatgggtccatc
agtaacacctttgatgagaaaagcacttttggacgtgtggaagtctttaatttgcatcca
gagaaggttcatacactaaaggcctgggtgatgaataacatcgaaagtgtccccagtgac
tcatgctcaagttcctccgtgaataatctgaaacagattctcaagacaaggaatattaca
tttgtctgccagaataactacaggcctgtcaggcttattcagtgtgtgaaaaatcctgag
cactcatcttgcagatataacttatga

DBGET integrated database retrieval system