KEGG   Vulpes vulpes (red fox): 112920302Help
Entry
112920302         CDS       T05911                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03040  Spliceosome
vvp04010  MAPK signaling pathway
vvp04141  Protein processing in endoplasmic reticulum
vvp04144  Endocytosis
vvp04213  Longevity regulating pathway - multiple species
vvp04612  Antigen processing and presentation
vvp04915  Estrogen signaling pathway
vvp05134  Legionellosis
vvp05145  Toxoplasmosis
vvp05162  Measles
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112920302 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112920302 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112920302 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112920302 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    112920302 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112920302 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    112920302 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112920302 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    112920302 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112920302 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA MetOD2
Motif
Other DBs
NCBI-GeneID: 112920302
NCBI-ProteinID: XP_025854814
UniProt: A0A3Q7S6I9
Position
Unknown
AA seq 646 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagggacctgcagtcgggatcgatcttggcaccacctactcctgcgtgggtgtc
ttccagcacgggaaagtggaaataattgccaatgatcagggaaaccgaaccaccccaagt
tatgtcgccttcacggacaccgaacgattgatcggtgatgctgcgaagaatcaagttgca
atgaaccccaccaacacggttttcgatgccaagcggctgattggacgtagatttgatgat
gctgtcgtccaatctgatatgaaacattggcccttcatggtggtgaatgatgctggcagg
cctaaagtccaagtagaatacaagggggagaccaaaagtttctatccagaggaggtgtcc
tctatggtcctgacgaagatgaaggaaattgcagaggcctaccttgggaagactgttact
aatgcagttgtcacggtacctgcatacttcaatgactctcagcgtcaggctaccaaagat
gctggaactattgccggtcttaatgtacttcgaattatcaatgagccaactgctgctgct
attgcttatggcttagacaagaaggttggagctgaaaggaacgtgttgatctttgattta
ggaggtggcacttttgatgtgtcaatcctgactattgaagatgggatctttgaggtcaag
tccacagctggagacacccacttaggtggagaagactttgacaaccgaatggtcaaccat
tttattgcagaattcaagcgcaaacacaagaaggacatcagcgaaaacaagagggccgtc
cgccgtctccgtactgcatgtgaacgggctaagcgtacactttcttccagcacccaggcc
agtatcgagattgattctctgtatgaaggaatcgacttctatacctctattactcgtgcc
cggtttgaagaattaaatgctgacctgttccgtggcaccctggaccctgtagagaaagct
cttcgagatgccaagctggacaagtctcagatccatgacattgtcctggtgggtggttct
acccgtatccccaagattcagaaacttctgcaagatttcttcaatggaaaggaactgaat
aagagcatcaaccctgatgaggccgttgcttatggtgcagctgtccaggcagccattctt
tctggtgacaaatctgaaaatgttcaagatttgctgctattggatgtcaccccgctttct
cttggcattgaaactgctggaggagtcatgactgtgctcattaagcgcaatactaccatt
cctaccaaacagacacaaacctttactacctactctgacaaccagcctggtgtgcttatt
caggtctatgaaggtgagcgtgctatgaccaaggataacaacctacttggcaagtttgaa
ctcacaggcatacctcctgctcctcgtggtgttcctcagattgaagtcacttttgatatt
gatgctaatggtatcctcaatgtgtctgctgtggataagagcacaggaaaagagaacaag
attaccatcactaacgacaagggccgcttgagcaaggaggacattgagcgcatggtccag
gaagctgagaagtacaaagctgaagatgagaagcagagagacaaggtgtcttccaagaat
tcacttgagtcgtacgctttcaacatgaaagcaactgttgaagatgaaaaacttcagggc
aaaatcaatgatgaagacaaacagaagattcttgacaagtgcaatgaaatcatcaactgg
ctcgataagaaccagactgcagagaaggaagaatttgaacatcagcagaaagagctggag
aaagtctgcaatcccatcattacgaagctataccagagtgcaggaggcatgccaggagga
atgcctggaggctttcctggtggtggagctcctccctctggtggtgcctcctctgggcct
accattgaagaggttgattaa

DBGET integrated database retrieval system