KEGG   Vulpes vulpes (red fox): 112920354
Entry
112920354         CDS       T05911                                 

Gene name
SCN2B
Definition
(RefSeq) sodium channel subunit beta-2
  KO
K04846  voltage-gated sodium channel type II beta
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:vvp04040]
    112920354 (SCN2B)
Ion channels [BR:vvp04040]
 Voltage-gated cation channels
  Sodium channel, voltage-gated (Nav)
   112920354 (SCN2B)
SSDB
Motif
Pfam: V-set ig Ig_3 I-set Adeno_E3_CR2 EphA2_TM Syndecan Ig_2
Other DBs
NCBI-GeneID: 112920354
NCBI-ProteinID: XP_025854924
UniProt: A0A3Q7S6R1
Position
Unknown
AA seq 259 aa
MLYVSLKYICAFFFLASNHSSLVALGPSNHPLPHPTRLTSQSLKMHRDAWLPRPAFSLTG
LSLFFSLVPPGRSMEVTVPTTLNVLNGSNARLPCTFNSCYTVNHKQFSLNWTYQECSNCS
EEMFLQFRMKIINLKLERFRDRVEFSGNPSKYDVSVTLRNVQLEDMGTYNCYIMNPPDRH
RGHGRIQLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSADDL
KTDEEGKTDGEGNADDGPK
NT seq 780 nt   +upstreamnt  +downstreamnt
atgttgtatgtgtctttgaagtacatctgtgcatttttttttttagcatctaaccattcc
tcccttgtagccctcggcccctcaaatcaccctctcccccatcccacccgactaacatct
cagtccctgaaaatgcacagagatgcctggctacctcgccctgccttcagtctcacgggg
ctcagtctctttttctctttggtgccaccagggcggagcatggaggtcacagtacctacc
accctcaacgtcctcaatggctctaatgcccgtctgccctgtaccttcaactcctgctac
acagtgaaccacaaacagttctccctaaactggacttaccaggagtgtagtaactgctca
gaggagatgttcctccagttccgcatgaagatcatcaacctgaagctggagcggttccga
gaccgcgtggagttctcggggaaccccagcaagtatgatgtgtccgtgacgctgagaaac
gtacagctcgaagatatgggcacctacaactgctacatcatgaacccgcccgaccgccac
cgcggccatggcaggatccaactgcaggtcctcatggaagagccccctgagcgggactcc
acagtggccgtgatcgtgggcgcctccgtgggcggcttcctggcggtggtcatcctggtg
ctgatggtagtaaagtgtgtgaggaggaaaaaagagcagaaactgagcgccgacgacctg
aagacggacgaggagggcaagactgatggagagggaaacgcggacgacggccccaagtaa

DBGET integrated database retrieval system