KEGG   Vulpes vulpes (red fox): 112920667Help
Entry
112920667         CDS       T05911                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00260  Glycine, serine and threonine metabolism
vvp01100  Metabolic pathways
vvp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    112920667
Enzymes [BR:vvp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     112920667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 112920667
NCBI-ProteinID: XP_025855267
UniProt: A0A3Q7T5A8
Position
Unknown
AA seq 435 aa AA seqDB search
MLRGLARAAAQRYGAPRPRGCGSGAGVPVHQVDLRSDTVTKPGPAMRRAMAEAVVGDDDY
EMQIPGPRTYTAARQGTPVTGVRVKVSGSPSRRKEGALWTGLPVPSSLPSAELQEKAAKL
LGVERTLFVPTNTMANLISVMGHCQRRGSQLLLGQECHLHVYEQGGVAQIAGVHSHPLPD
LPHGTLDLAELERMVTRGLGSPYHPVCELICLENTHSSSGGRVLPIDYLRQVHRLAQSYG
VRVHLDGARLMNAAVALRVSPARIVEHCDSVSLCFSKGLGAPVGALVGGPKDFIEGAWRL
RKALGGGMRQAGVLAAAALVGLADAEEVLLRDHQNAQRFARGLQELASPICSVDVAAVET
NMVMVTVDGLAPEELCRRLRAVSAAEVAQTGRAVRVLLFPWSERSVRAVWHRDVSAQDTE
LALRKWEFVLRQLGP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcggactggcccgggccgcggcccagcgctacggggccccccggccgcggggg
tgtgggagcggggcgggggtcccggtgcaccaggtggacctgcgcagcgacacggtgacc
aagcccgggccggccatgaggcgcgccatggccgaggcggtcgtgggggacgacgactac
gaaatgcagatcccagggccccgcacttacacagctgcccgccaagggacgcccgtgacc
ggggtgcgcgttaaggtgtcgggcagcccgagcagacgcaaggagggtgcattgtggacg
ggtctccctgtaccctcatcccttccctccgcagagctgcaggaaaaggccgccaagctg
ctgggggtggagcggaccctgtttgtgcctaccaacaccatggccaacctcatctctgtg
atgggtcactgccagcgcaggggctcccagctcctcctcgggcaggagtgccacctccac
gtctacgagcagggcggggtggctcagatcgctggggtgcactcccaccccctcccagac
ctgccccatggcaccctggacctggctgagctggagaggatggtcacacggggcctgggg
agcccctaccacccggtctgtgagctcatttgcctggagaacacccacagcagctcaggg
ggtcgggtcctccccatcgactacctacgccaggtgcaccgcctggcccagagctacggg
gtccgggtccacctggacggggcccggctgatgaatgctgcggtggctctgcgtgtgtcc
cccgcccgcatcgtggagcactgcgactctgtgtctctctgtttctccaagggcctgggc
gcacccgtgggggccttggttgggggacccaaggacttcattgaaggagcctggcgcctc
cggaaagccctgggcggagggatgcgccaggccggggtgctggcggcagccgccctagta
ggactggcggacgccgaggaggtactgctgagagaccaccagaacgctcagagattcgcc
agagggctccaggagctggcgtcccccatctgctccgtggacgtcgccgccgtggagacg
aacatggtgatggtgacggtggacgggctggcgcccgaggagctctgccggcgtctgcgg
gccgtgagcgctgccgaggtggcccagaccgggcgcgcggtgcgcgtgctgctgttcccc
tggagcgagcggtcggtgcgcgccgtgtggcaccgcgacgtctccgcgcaggacaccgag
ctggcgctgaggaagtgggagttcgtgctgaggcagctggggccctga

DBGET integrated database retrieval system