KEGG   Vulpes vulpes (red fox): 112921612Help
Entry
112921612         CDS       T05911                                 

Gene name
NKTR
Definition
(RefSeq) NK-tumor recognition protein isoform X1
  KO
K12740  NK-tumor recognition protein
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:vvp03110]
    112921612 (NKTR)
Chaperones and folding catalysts [BR:vvp03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    112921612 (NKTR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 112921612
NCBI-ProteinID: XP_025856711
UniProt: A0A3Q7SMG4
Position
Unknown
AA seq 1444 aa AA seqDB search
MGAQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYK
GSTFHRVVKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNG
SQFFITTKPAPHLDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCGVLATKS
TKDVFEKKRKKPTHSEDSESSSNSSSSSESSSESEIEHERSRRRKHKRRPKVKHSKKRRK
EASSSEEPRNKHITSPKGHSERSDTNEKRSVDSNAKREKPVVRPEEIPPVPENRFLLRRD
MPLVTVEPEPKIPDVTPIVSDQKPSVSKSGRKIKGRGTIRYHTPPRSRSCSESDDDDSSE
TPPHWKEEMQRLRAYRPPSGEKWSKGDKLSDPCSSRWDERSLSQRSRSWSYNGYYSDLST
ARHSDGHHKKRRKEKKVKHKKKTKKQKHCRRHKQTKKRRIIVPSDIESSKSSTRRMKSSC
DRERRSRSSSLSSHRSSKRDWSKSDKDDQSSSTHSSRDSYRSKSHSQSYSRGSSRSRTPS
KSSSHSRSRSKSRSTSKSGHQRTTSKSPRRTTSQLSESKAVKTEPLRATAPQNENVVVQP
VVAENIPVIPLSDSPPPSRWKPGQKPWKPSYERIQEMKAKTTHLLPLQSTYSLANIKETG
SSSSYHKREKNSESDRSAYSKYSDRSSESSPRSRSRSSRSRSYSRSYTRSRSLASSHSRS
RSASSRSHSRNKYSDRSQCSRSSSYSSVSSDDGRQAKRKFRSNGKKNNTSSKKHSGSSEK
RLHHKYVKNRDKSSSQRKYSESRSSLDYSSDSDQSSVQVTQSAQEKEKQVQMEMNNKQEK
NRDEEKSKPEQECPRSKKRVLRENLSDHLRNGSKPKRKNYAGSKWDSGSNSERDITKNSK
NISRPSSDKEEGEATSDSESEFGEIHSKAKPATKSSASASLPDGNGAWKSGKQQSSTSDS
EGSYSNSENTRRKARKRKHGSKETLKREQTKKAKEKLKGKKDKKHKAPKRKQAFHWQPPL
EFGEEEEEEISEKQVTQEAKEKKQVSENSETMKENIPHTEKSCEEGNFSGKCNPVTTSSD
MDQPAKEDTKLSASPTALITEENVTASPSNIQPIAESVPSGVEDVLQTDDNMEICTPDRS
SPAKEASPLGNSRLATADVNIVLKQDMHTEHPETEESKQESSMSESQAMGDVGKQDSSPA
SLASTIESTVKREVAEKSQISLMDNKWKPLQGVGNLAPPTASTSSTVEVKALTTAPDMKP
QGLRIEIKSKNKVRPGSLFDEVRKTARLNRRPRNQESSSDEQTPSRDGDSQSRSPSRSRS
KSETKSRHRTRSVSYSHSRSRSRSSTSSYRSRSYSRSRSRGWYSRGRTRSRSSSYRSYKS
HRSYTYDSYYSRSRSRSRSQRSDSYHRGRSYNRRSRSCRSYGSDSESDRSYSHHRSPSES
STYS
NT seq 4335 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcaggaccggccgcagtgccacttcgacatcgagatcaaccgggagccggtt
ggtcgcattatgtttcagctcttctcagacatatgtccaaaaacatgcaaaaacttcctt
tgcctatgctcaggagagaaaggccttgggaaaacaactggaaagaagttatgttacaaa
ggttctacattccatcgtgtggttaaaaactttatgattcagggtggggacttcagcgaa
ggtaatggaaaaggcggagaatcaatttatggtggatattttaaagatgaaaactttatt
ctcaaacatgacagagcgttccttttgtcaatggcaaatcgagggaaacataccaatggt
tcccagtttttcattaccacaaaacctgctccacacctggatggggtgcatgtcgtcttt
ggattagttatttctggttttgaagtaatcgaacagattgaaaatctgaaaacagatgct
gcaagtagaccttatgcagatgtgcgagttattgattgtggggtgcttgccacaaaatca
acaaaagatgtttttgagaagaaaaggaagaaaccaactcattcagaagactcggaatcc
tcttccaattcctcttcctcttcagaatcttcttcagaaagtgaaattgaacatgagaga
agcagaagaaggaaacataagaggaggccaaaagttaaacattctaaaaagagacgaaag
gaagcaagcagttcagaggagccaaggaataaacatataacgagcccaaaaggtcactct
gagaggagtgataccaatgaaaaaaggtcagttgattcaaatgctaaaagggaaaagcct
gtagtccgtccagaggagattcctccagttcctgagaaccgatttttactgagaagagat
atgcctcttgtcacggtggagcctgaaccgaagattcctgatgttacacccattgtaagt
gatcagaaaccttctgtatcaaaatctggacggaagattaaaggaaggggcacaattcgc
tatcacacacctccaagatcaagatcatgttctgaatcagatgatgatgatagcagtgaa
actcctcctcactggaaagaggaaatgcaaagattaagagcatacagaccacctagtgga
gaaaaatggagtaaaggagataaattaagtgatccctgttcaagccgatgggatgagaga
agtttgtcccagagatccaggtcgtggtcttataatggatattattcagaccttagtaca
gcaaggcactctgatggtcaccataaaaaacgcaggaaagagaaaaaagttaaacataaa
aagaaaactaaaaagcagaaacattgcagaagacacaagcagactaagaagagaaggatt
attgtaccatcagacatagaatcctcaaaatcctccacccgacgaatgaaatcctcttgt
gacagagaaaggagatctcgttcttcctcgttatcatctcatcgctcctcaaagagggac
tggtctaaatctgataaggatgaccagagctcttcaacccattccagcagagactcctac
agatctaaatctcactcgcagtcttattctagaggaagctcaagatcaaggactccctca
aaatcctcatcacattctcgaagtagatcaaagtccagatctacttccaagtcagggcac
caaaggacaacatcaaaatcaccaagaagaacaacctctcagttaagtgaaagtaaagca
gttaaaacagaacccttaagagcaacagcaccacaaaatgaaaacgtcgtagtacaacca
gtggtggcagaaaatattcctgtaataccattgagtgacagtccccctccttcaaggtgg
aagcctggacagaagccctggaagccctcttacgagcgaattcaggaaatgaaagctaaa
acaacccatttgctgcccctccaaagcacttacagtttagcaaatattaaagagactgga
agttcatcatcctaccataagagagaaaaaaattcagaaagtgatcggagtgcttattca
aagtatagtgatagaagttcggaaagttcaccaaggtcaaggagcagatcttctaggagt
agatcttattccagatcatacacaaggtcacgaagtcttgctagttcacattcaagatct
aggtctgcctcctctagatctcattcacgaaataaatacagtgatcgttcacagtgtagt
agatcctcgtcatactcttctgttagcagtgatgatggaagacaagccaagagaaaattt
agatccaacgggaaaaaaaataacacttcaagtaagaagcacagcggcagctctgaaaag
agacttcaccataaatatgtgaaaaacagagacaagtcttcaagtcagagaaagtatagt
gaaagcaggtcatctttagattattcttcagacagtgaccagtcaagtgttcaggttaca
cagtcagcccaggaaaaagagaagcaagtccaaatggaaatgaacaataagcaagagaag
aacagagatgaagagaaatctaagcctgaacaggaatgccctcgttctaagaaaagagtc
ttgagagagaatctttctgatcaccttagaaatggcagtaagcccaaaagaaaaaattat
gctgggagtaagtgggactctgggtcaaattctgaacgagatataacaaaaaacagtaaa
aatatttcccggccatcttctgataaggaggaaggtgaggctacatcagattctgagtca
gagtttggtgaaattcacagcaaagccaaacctgcaacaaagtcttcagcaagtgcttcg
ctgcctgatggtaatggtgcttggaaatcaggtaagcagcagtcttcgacctctgattct
gagggttcctattccaattcagaaaacactagaagaaaggcacggaagcgcaaacatggg
tcaaaggaaactcttaaaagagagcagaccaaaaaagcaaaggagaaactgaaagggaaa
aaagacaaaaagcacaaggctccaaaacgaaaacaggcatttcactggcagcctccacta
gaatttggtgaggaggaggaggaggagattagtgaaaaacaagttactcaggaggcaaaa
gagaaaaaacaagtttctgaaaatagtgaaaccatgaaagaaaatattccacacactgag
aagtcctgtgaagagggcaacttttcaggtaaatgcaatccagtcacgacttcttcggat
atggatcagcctgctaaagaggatactaaactcagtgcttctcccacagccttaatcact
gaggagaatgtcactgcttctccctccaacattcagcctattgcagaaagtgtcccaagt
ggagtggaggatgtgctgcagacagatgacaacatggagatctgtactcctgataggagt
tccccagcaaaggaggcatcccctctagggaattcaaggcttgccactgcagacgtaaac
attgttctaaaacaggatatgcacacagagcatcctgagacagaggagtcaaaacaggag
agcagtatgtccgaaagtcaagcaatgggggatgtggggaaacaggacagcagccctgct
agcttggccagcactatagaaagcactgtgaagagagaggtggcagagaagagccagatc
agtctcatggataacaaatggaagcccctgcagggtgtggggaacctggcgccaccaact
gcttccacatccagcactgtggaggtaaaggcattgactactgcacctgacatgaagcca
caaggcctgaggatagaaattaaaagcaaaaataaagttcggcctgggtctctctttgat
gaagtaagaaagacagcacgcttaaaccggaggccaaggaatcaggagagttcaagtgat
gagcagacacctagtcgggatggggatagccagtccaggagtccaagcagatctcgaagt
aaatctgaaaccaaatcaagacacagaacaaggtctgtctcctacagtcactcaagaagt
cgatcacgaagctctacatcatcttaccgatcaagaagctattctagaagtcggagcaga
ggatggtacagcagaggccgcacaagaagccggagcagttcctaccgcagttacaaaagt
cataggtcctacacttacgatagctactatagcaggagtcggagtcgaagtaggagccag
aggagtgacagttaccaccgaggcagaagttataacaggcgatccaggagttgtagatct
tatggctccgacagtgaaagtgaccgaagttactctcatcaccggagccccagtgaaagt
agcacatatagttga

DBGET integrated database retrieval system