KEGG   Vulpes vulpes (red fox): 112921990Help
Entry
112921990         CDS       T05911                                 

Gene name
ZDHHC21
Definition
(RefSeq) palmitoyltransferase ZDHHC21 isoform X1
  KO
K18932  palmitoyltransferase [EC:2.3.1.225]
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112921990 (ZDHHC21)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.225  protein S-acyltransferase
     112921990 (ZDHHC21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHHC
Motif
Other DBs
NCBI-GeneID: 112921990
NCBI-ProteinID: XP_025857203
UniProt: A0A3Q7SL44
Position
Unknown
AA seq 289 aa AA seqDB search
MGLRIHFVVDPHGWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGIAIFC
LVALVRASFTDPGRLPENPKIPHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHC
PWINNCVGEDNHWLFLQLCFYTELLTSYALMFSFCHYYYFLPVKKRNLDLFVVRHELAIM
RLAAFMGITMLVGITGLFYTQLIGIITFLMMNGWKWTFGMLLLRVQVTYKGHWVYSWGQQ
FPSYPAAPEASEKEVWQQSLQKSFKNLHSKILVFTFELAIKLFFAFVAF
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgggtctccggattcactttgttgttgatccacatggttggtgctgcatgggtttgatt
gtctttgtctggttatacaatattgttttaattcccaaaattgtcctctttcctcactat
gaagaaggacatattccaggcatattaataataatattctatggcattgccatattttgt
ctggttgcattagtgagggcctcatttactgatccaggaagactccctgagaaccctaag
attccacatggagaaagggagttctgggaattatgtaacaaatgtaatttgatgagacca
aagcgttcccatcactgtagccgctgtggccactgtgttaggagaatggatcatcactgt
ccatggattaacaattgtgtcggtgaagataatcattggctttttctgcagttgtgtttc
tacacggaacttcttacttcttatgcactgatgttttctttctgccactattattacttt
cttccagtaaaaaagcgaaacttggacctctttgttgttaggcatgaattggccataatg
agactagctgcctttatgggcatcactatgttagttggaataactggacttttttatact
cagctaattggcatcatcacatttctaatgatgaatggctggaaatggacatttgggatg
ttgctgctaagagtgcaagttacttataagggtcattgggtttatagctgggggcaacag
tttccttcttacccagcagccccagaagcttcagagaaggaagtttggcagcaaagtctt
caaaaatctttcaagaatctccactctaaaattttagtgttcacttttgaattggccata
aagttattttttgcatttgttgctttttaa

DBGET integrated database retrieval system