KEGG   Vulpes vulpes (red fox): 112922828Help
Entry
112922828         CDS       T05911                                 

Gene name
CDK15
Definition
(RefSeq) cyclin-dependent kinase 15
  KO
K15594  cyclin-dependent kinase 15 [EC:2.7.11.22]
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112922828 (CDK15)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     112922828 (CDK15)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  CDK family
   112922828 (CDK15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like Seadorna_VP7 Antimicrobial25
Motif
Other DBs
NCBI-GeneID: 112922828
NCBI-ProteinID: XP_025858259
UniProt: A0A3Q7SD36
Position
Unknown
AA seq 438 aa AA seqDB search
MGQELCTRTARPGCSCHRCGEGGEAHSGRGTVPEPGPAAEAAIQLTDLKEASCSMTSFHP
KGLQAVHARKCKSKRPRSNSDSFQEEDLRQGFQWKKSLPFGAASSYLNLEKLGEGSYATV
YKGISRINGQLVALKVISMNAEEGVPFTAIREASLLKGLKHANIVLLHDIIHTKETLTFV
FEYMHTDLAQYMCQHPGGLHPHNVRLFMFQLLRGLAYIHHQHVLHRDLKPQNLLISHLGE
LKLADFGLARAKSIPSQTYSSEVVTLWYRPPDALLGATEYSSELDIWGAGCIFIEMFEGQ
PLFPGVSNILEQLEKIWEVLGVPTEDTWPGVSKLPNYNPEWFPLPKPQSLQNVWNRLGRV
PEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLHQLPDEESLFTVSGVRLKPEMCD
LLVSYRKGHHPAQFSKCW
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaggagctgtgtacaaggactgcccggcctggctgcagctgccaccgctgcggg
gagggaggcgaagcgcacagcggccgggggacggtgccggagcctgggccggcggcggag
gctgcgatccagctaacagacctaaaagaagcatcatgttccatgacttcatttcacccc
aagggacttcaggctgtgcatgcccggaagtgcaagagtaaaaggccacggagtaacagt
gattcttttcaggaagaggatctgaggcagggttttcagtggaagaagagcctccctttt
ggggcagcctcatcttacctgaacttggagaagctgggtgaaggttcttatgctacagtt
tacaaggggattagcaggataaatggacaactagtagctctaaaagtcatcagcatgaat
gcagaggaaggagtcccatttacggctattcgggaagcttctctcttgaagggtttgaaa
catgccaatatcgtgctcctgcatgacataatccacaccaaagagacattaacattcgtt
tttgaatacatgcatacagacctggcccagtacatgtgtcagcacccaggagggcttcat
cctcacaatgtcaggcttttcatgtttcaacttttgcggggcctggcgtacatccaccac
caacacgttcttcacagggacctgaaacctcagaacttactcatcagtcacctgggagag
ctcaaactggctgattttggtcttgcccgggcgaagtccattcccagccagacatactct
tcagaagttgtgaccctctggtaccggcctccggatgccttgctgggagccactgaatat
tcctctgaactggacatatggggtgcaggctgcatctttattgaaatgttcgagggtcaa
cctttgtttcctggggtttccaacatccttgaacagctggagaagatctgggaggtgttg
ggagtccctacagaggatacctggcctggagtttccaagctacctaactacaatccagaa
tggttcccattgcccaagccacaaagccttcagaatgtctggaacaggttgggcagggtt
cccgaagctgaagacctggcctcccaaatgctaaaaggctttcctagagaccgtgtctct
gcccaggaagcactggttcatgactacttcagtgccttgccatctcagctgcaccagctt
cctgatgaggagtctttgtttacagtttcaggagtgaggctaaagccagagatgtgtgac
cttttggtctcctaccggaaaggtcaccacccagcccagtttagcaaatgctggtga

DBGET integrated database retrieval system