KEGG   Vulpes vulpes (red fox): 112923681
Entry
112923681         CDS       T05911                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00230  Purine metabolism
vvp00240  Pyrimidine metabolism
vvp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112923681 (DCK)
   00240 Pyrimidine metabolism
    112923681 (DCK)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     112923681 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 AAA_28 Thymidylate_kin Phage_lysozyme
Other DBs
NCBI-GeneID: 112923681
NCBI-ProteinID: XP_025859290
UniProt: A0A3Q7TVI1
Position
Unknown
AA seq 260 aa
MATPPKRSCPSPAAGPEGARIKKIAIEGNIASGKTTFVNILKHVCEDWEVVPEPVARWCN
VQSAQGDCEELTTSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLACLDGKLKDAE
KPVLFFERSIYSDRYVFAANLYESECMNETEWTIYQDWHDWMNHQFGQSLELDGIIYLRA
TPEKCLNRIYLRGRNEEQGIPLEYLEKLHYKHESWLLHRTLKTNFDFLQEIPILILDINE
DFKDKHDGLIEKVKEFLSTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atggccaccccgcccaagagaagctgcccgtctcccgcggccggccccgagggagcccgc
atcaagaaaatcgccatcgaagggaacatcgcctcagggaagacaacatttgtgaatatc
cttaaacatgtctgtgaggattgggaagtggttcctgaacctgttgcccgttggtgcaat
gttcaaagtgctcaaggtgactgtgaggaactgacaacatctcagaaaagtggtgggaat
gttcttcagatgatgtatgagaagcctgaacggtggtcttttaccttccagtcatatgcg
tgccttagtcgaatacgagcccagcttgcctgtcttgatggcaagctcaaagatgcagag
aaacctgtattattttttgaacgatctatatatagtgacaggtatgtctttgcagctaat
ctgtatgaatctgagtgcatgaatgaaacagagtggacaatttatcaagactggcatgac
tggatgaatcaccaatttggccaaagcctggaactggatggaatcatttatcttcgagcc
actccagagaaatgcttgaatagaatatatttgcggggaagaaatgaagaacaaggcatt
cctcttgaatatttagagaagcttcactataagcatgagagctggctactgcatagaaca
ctgaaaaccaactttgattttctacaagaaatccctatcttaattctggatatcaatgaa
gactttaaagacaaacacgatggtcttattgaaaaggtcaaagaatttttgagcactttg
tga

DBGET integrated database retrieval system