KEGG   Vulpes vulpes (red fox): 112924880Help
Entry
112924880         CDS       T05911                                 

Gene name
ANXA11
Definition
(RefSeq) annexin A11
  KO
K17095  annexin A7/11
Organism
vvp  Vulpes vulpes (red fox)
Brite
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112924880 (ANXA11)
  Exosomal proteins of other body fluids (saliva and urine)
   112924880 (ANXA11)
  Exosomal proteins of colorectal cancer cells
   112924880 (ANXA11)
  Exosomal proteins of bladder cancer cells
   112924880 (ANXA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Annexin Ribosomal_S6e
Motif
Other DBs
NCBI-GeneID: 112924880
NCBI-ProteinID: XP_025861264
UniProt: A0A3Q7SIQ8
Position
Unknown
AA seq 505 aa AA seqDB search
MSYPGYPPPAGGYPPAAPGGGAWGGAGYPPPSMPPIGLDNMANYAGQFNQDYLSGMASNM
SGTFGGANVPNLYPGAPGGGYPPMPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSGMPSYP
PYPGAPVPGQPMPPPGQQPPGPYPGQPPMTYPGQPPMPPSGQQQQPVPSYPGYLGSGTVT
PAVPPARFGNRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILL
SFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKDAIKGAGTDEACLIEIFA
SRSNEHIRELSRAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMTLVQRD
AQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQ
GMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSEIDLLDIRMEYKRLYGKS
LYHDISGDTSGDYQKILLKICGGND
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgagctacccaggctatcccccgcccgcaggaggctaccccccagctgcaccaggtggc
ggtgcctggggaggtgctggctaccccccgcccagcatgccccccatcgggctggataac
atggccaactacgcagggcagttcaaccaggactacctctcgggaatggcatccaacatg
tccgggacattcggaggagccaatgtgccaaacctgtaccctggggcccccgggggtggt
taccctcccatgccccctgggggttttgggcagcccccttccgcccagcagcctgttcct
ccgtatggaatgtatccaccccctggagggaacccgccctctgggatgccttcatacccg
ccatacccaggggcccctgtgccaggccagcccatgccgccccctggacagcagccccca
gggccctaccccggacagccgccaatgacctaccctgggcagccgccgatgccaccttcc
gggcagcagcagcagccagtgccaagctacccaggatacctggggtccgggaccgtcacc
cctgctgtgcctccagcccggtttggaaaccgaggcaccatcacagacgctcctggcttt
gaccccttgcgagatgctgaggtcctgcggaaagctatgaagggctttgggaccgacgag
caggccatcatcgactgcctggggagccgctccaacaagcagcggcagcagatcctcctg
tccttcaagactgcttatggcaaggatttgatcaaagatctgaaatctgaactgtcagga
aactttgagaagacaatcttggctctaatgaagacccccgtcctcttcgatgtttatgag
ataaaggatgccatcaagggggccggcactgacgaagcctgcttgatcgagatcttcgcc
tcccgcagcaacgagcacatccgggagttaagcagagcctacaaaacagaattcaaaaag
accctggaggaggctatccgaagtgacacatcagggcactttcagcggctcctcatctct
ctgtctcagggaaaccgggatgagagcaccaacgtggacatgacgctggtgcagagggac
gcccaggagctgtatgcggctggggagaaccgcctgggaacagatgagtccaagttcaac
gcaattctgtgctcccggagccgggcccacctggtggcagttttcaacgagtatcagcgg
atgacaggtcgcgacattgagaagagcatctgccgggagatgtccggggacctggagcag
ggcatgctggccgtggtgaaatgtctcaagaataccccagccttctttgccgagaggctc
aacaaggccatgaggggagcgggaacgaaggaccggaccctgattcgcatcatggtgtct
cgcagtgagatcgacctcctggacatcagaatggagtataagcggctgtacggcaagtcg
ctgtaccacgacatctcgggagacacttcgggggattaccagaagattctgctgaagatc
tgcggtggcaacgactga

DBGET integrated database retrieval system