KEGG   Vulpes vulpes (red fox): 112925488Help
Entry
112925488         CDS       T05911                                 

Gene name
ATG16L1
Definition
(RefSeq) autophagy-related protein 16-1 isoform X1
  KO
K17890  autophagy-related protein 16-1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04136  Autophagy - other
vvp04140  Autophagy - animal
vvp04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112925488 (ATG16L1)
   04136 Autophagy - other
    112925488 (ATG16L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112925488 (ATG16L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112925488 (ATG16L1)
   03029 Mitochondrial biogenesis [BR:vvp03029]
    112925488 (ATG16L1)
Membrane trafficking [BR:vvp04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    112925488 (ATG16L1)
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    112925488 (ATG16L1)
Mitochondrial biogenesis [BR:vvp03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    112925488 (ATG16L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATG16 WD40 ANAPC4_WD40 eIF2A Fez1 HALZ Phage_GPO V_ATPase_I
Motif
Other DBs
NCBI-GeneID: 112925488
NCBI-ProteinID: XP_025862013
UniProt: A0A3Q7SY85
Position
Unknown
AA seq 765 aa AA seqDB search
MKERSPTKRTTNPGKAAKGTKRKPTGGGGDSSAARTPPSGRLSAPRASGLGSASLASARR
RPWSRARARRQTSGEEAGFPALTPALSGKSRKTVPDGSWRGGVWKRGVGRRPFRRALVAH
AAARGCRPPLGLAALSAGAAREMSSGLRAADFPRWKRHISEELRRRDRLQRQAFEEIILQ
YNKLLEKSDLHSVLAHKLQAEKHDIPNRHEISPGHDGAWNDGQLQEMAQLRIRHQEELTE
LHKKRGELAQLVIDLNNQMQQKDREMQMNEAKIAECLQTISDLETECQELRSKLQDLERA
NQTLKDEYDALQITFTALEEKLRKTTEENQELVTRWMAEKAQEANRLNAENEKDSRRRQA
RLQKELAEAAKEPLPVEQDDDIEVIVDETSDHAEETSPVRAISRAATKRLSQPAGGLLDS
ITNIFGLSESPLLGHHSSDAARRRSVSSFPVPQDNVDTHPGSSKEVRVPTTAMCIFDAHD
GEVNAVQFSPGSRLLATGGMDRRVKLWEVFGDKCEFKGSLSGSNAGITSIEFDSAGSYLL
AASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVC
IKTVFAGSSCNDIVCTEQCVMSGHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTE
LLSCSRDDLLKIIDLRINAVRQTFSAPGFKCGSDWTRVVFSPDGGYVAAGSAEGSLYIWS
VLSGKVEKVLSKQHGSSINAVAWSPSGSHVVSVDKGSKAVLWSEY
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaggagtccgaccaagagaactacaaatccggggaaggcagcgaagggaacg
aagcgcaaaccgacaggcggcggcggagactccagcgcagcccgcacgcctcccagcggc
cgcctctccgcaccccgcgcttccggcctcgggagcgcgtcattagccagcgcccggcgt
cgcccctggtcacgtgcgcgcgcgcggcgtcagacgtcgggtgaggaggcgggctttccg
gccctgaccccagccctttccggcaagagccggaagacggtcccggacggctcttggcgg
ggcggtgtgtggaagcgaggtgtgggccgccggcccttccggcgtgcgctggtcgctcat
gctgcggcccgcggctgccggcccccgctcggattagcggcgctcagcgccggggcagcg
cgcgagatgtcgtcgggcctccgcgccgccgacttcccccgctggaagcgccacatttcg
gaggagctgaggcggcgggaccggctgcagaggcaggcgttcgaagagatcatcctgcag
tataacaagttgctagaaaagtcagatcttcattcagtgctggcccataagctccaagct
gaaaagcatgacatccccaacaggcatgagataagtcctggacacgatggcgcatggaac
gacggtcagctacaggaaatggcccagctgaggatcagacaccaggaagaactgactgaa
ctacacaagaagcgcggggagttagctcaattggtgattgacctgaataaccaaatgcag
cagaaagacagggagatgcagatgaatgaagcaaaaattgcagaatgcttgcagacgatc
tctgacctggagacggagtgccaagaactacgcagtaagcttcaagacctagaaagagcc
aaccagaccctgaaggacgaatatgatgccctgcagatcacgtttactgctttggaggag
aaactgaggaaaactactgaagagaatcaggagctggtcacccggtggatggctgagaaa
gcccaggaagccaatcgcttaaatgcagagaatgaaaaggattcaaggagacggcaagcc
cggctgcagaaagagcttgcagaagcagcaaaggaacctctacccgttgaacaggatgat
gacattgaagtcattgtggacgaaacctctgatcacgctgaggagacgtctcctgtgcga
gccatcagcagagcagccactaagcgactctcgcagcctgctggaggccttctggattct
atcactaatatctttggtctgtccgagtctccccttttgggacatcactcttctgatgct
gccaggaggcgctctgtctcttcctttccagttccccaggataatgtggatactcatcct
ggttctagtaaagaagtgagagtgccaacaacagcgatgtgtatctttgatgctcatgat
ggggaagtcaacgctgtgcagttcagccccggctcccggctgctggccacaggaggcatg
gatcggagagttaagctttgggaagtgtttggagataaatgtgagttcaagggttccctg
tccggcagtaatgcgggaattacgagcatcgaatttgacagtgctggatcttacctctta
gcagcttcaaatgattttgcaagtcgaatctggactgtggatgattatcggttacggcac
acgctcacaggacacagtggcaaagtgctgtctgccaaattcctgctggacaatgcccgt
attgtttctggaagtcatgaccggaccctcaagctctgggatctacgcagcaaagtctgc
ataaagacggtgtttgcaggatccagctgcaacgatatcgtctgcacagagcagtgtgtc
atgagtggccattttgacaagaaaattcgtttctgggacatccgatcggagagcatcgtc
cgggagatggagctgctggggaagattacggccctggacttaaacccggaaagaacagaa
ctcctcagctgctcccgtgatgacctgctaaagatcatcgatctgcgaataaatgctgtc
aggcagacgtttagcgcacctgggttcaagtgcggctccgattggaccagagttgtgttt
agccctgatggtggttatgtggcagcgggctcggctgagggctctctctacatctggagc
gtgctctcagggaaagtggagaaagtcctttccaagcagcatggctcgtccatcaatgct
gtggcgtggtccccctccggctcgcacgttgtcagtgtggacaaaggaagcaaagctgtg
ctctggtcagaatattga

DBGET integrated database retrieval system