KEGG   Vulpes vulpes (red fox): 112926474Help
Entry
112926474         CDS       T05911                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: mast cell protease 4-like
  KO
K01329  chymase [EC:3.4.21.39]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    112926474
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:vvp01002]
    112926474
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.39  chymase
     112926474
Peptidases [BR:vvp01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   112926474
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 112926474
NCBI-ProteinID: XP_025863270
UniProt: A0A3Q7U7A5
Position
Unknown
AA seq 245 aa AA seqDB search
MQALLLLLACLLPPEAEAVEIISGIESKPMHSRPYMVYLEIITNEGYIASCGGFLISQEF
VMTAAHCKGRKITVTLGAHDMKQEESTWQKLEVSEQIIHPNYNTYTKLNDIMLLKLQTKA
KLTHTVGTIPLPTWSNFIPPGRICRAAGWGKTGAXVSDTPREVKLRLMDTAACNHYSFYN
HNLQICVGNPRKTRSAYKGDSGGPLLCAGVAQGIVSYGRGDAKPLAVFTRISPYVPWINK
ILKNI
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgcaagccctacttcttttattggcctgtctcttgcctcctgaagctgaagctgtggaa
attatcagtggcattgagtccaagccaatgcactcccgcccctacatggtctatctggaa
atcatcactaacgagggttatattgccagctgtggcgggtttctcataagtcaagaattt
gtgatgacagctgctcattgtaaaggaaggaaaattactgtcaccctgggagctcatgac
atgaaacaggaagaatccacatggcagaagctagaagtctcagaacaaatcattcaccca
aattataacacttacaccaaactcaacgacatcatgttactgaagctacaaacaaaagcc
aagctgacccacaccgtgggaacaatccccctgcccacctggtctaactttatcccacct
gggagaatctgcagggctgctggctggggaaaaacaggagctnnggtgtcagatacgccg
agggaggtcaagttgagactcatggacaccgcggcctgcaaccactattcgttttacaac
cataatttacaaatctgtgtgggcaatcccaggaagacaagatcagcgtacaagggggat
tctgggggccccctgttgtgtgcaggtgtggcccaaggcattgtttcttatggacgtgga
gatgcaaagcctcttgctgtcttcactcgaatctccccatatgtgccctggattaataaa
atcttaaagaatatatag

DBGET integrated database retrieval system