KEGG   Vulpes vulpes (red fox): 112926558
Entry
112926558         CDS       T05911                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00230  Purine metabolism
vvp01100  Metabolic pathways
vvp01522  Endocrine resistance
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04114  Oocyte meiosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04371  Apelin signaling pathway
vvp04540  Gap junction
vvp04611  Platelet activation
vvp04713  Circadian entrainment
vvp04714  Thermogenesis
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04727  GABAergic synapse
vvp04742  Taste transduction
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04913  Ovarian steroidogenesis
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04921  Oxytocin signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp04976  Bile secretion
vvp05032  Morphine addiction
vvp05163  Human cytomegalovirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112926558 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112926558 (ADCY4)
   04371 Apelin signaling pathway
    112926558 (ADCY4)
   04020 Calcium signaling pathway
    112926558 (ADCY4)
   04072 Phospholipase D signaling pathway
    112926558 (ADCY4)
   04024 cAMP signaling pathway
    112926558 (ADCY4)
   04022 cGMP-PKG signaling pathway
    112926558 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112926558 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    112926558 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112926558 (ADCY4)
   04062 Chemokine signaling pathway
    112926558 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    112926558 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    112926558 (ADCY4)
   04912 GnRH signaling pathway
    112926558 (ADCY4)
   04913 Ovarian steroidogenesis
    112926558 (ADCY4)
   04915 Estrogen signaling pathway
    112926558 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    112926558 (ADCY4)
   04921 Oxytocin signaling pathway
    112926558 (ADCY4)
   04926 Relaxin signaling pathway
    112926558 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    112926558 (ADCY4)
   04918 Thyroid hormone synthesis
    112926558 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    112926558 (ADCY4)
   04916 Melanogenesis
    112926558 (ADCY4)
   04925 Aldosterone synthesis and secretion
    112926558 (ADCY4)
   04927 Cortisol synthesis and secretion
    112926558 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112926558 (ADCY4)
   04270 Vascular smooth muscle contraction
    112926558 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    112926558 (ADCY4)
   04971 Gastric acid secretion
    112926558 (ADCY4)
   04972 Pancreatic secretion
    112926558 (ADCY4)
   04976 Bile secretion
    112926558 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    112926558 (ADCY4)
   04727 GABAergic synapse
    112926558 (ADCY4)
   04725 Cholinergic synapse
    112926558 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    112926558 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    112926558 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    112926558 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    112926558 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    112926558 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112926558 (ADCY4)
   04714 Thermogenesis
    112926558 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112926558 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    112926558 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    112926558 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112926558 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112926558 (ADCY4)
   05163 Human cytomegalovirus infection
    112926558 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112926558 (ADCY4)
Enzymes [BR:vvp01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     112926558 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N CD52
Other DBs
NCBI-GeneID: 112926558
NCBI-ProteinID: XP_025863409
UniProt: A0A3Q7SMP8
Position
Unknown
AA seq 1217 aa
MRLLPGHPCRLGWREEERGMAPAASPRRLGKGWAAPGSAGGRARARLDPSEPGAAPALTR
PRARAPSPEFALRPRPRRSRAGPTMARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGI
VLCALLAVLAVASASGRDLASDPGFLITVLCALGGFSLLLGLASCEQRLQRWTRPLSGLV
WAALLGLGHGFLFTGGLVSAWDQVSFFLFVIFTVYAMLPLGMRDATAAGLASSLSHLVVL
GLYLGPQPDSQPALLPQLAANAVLFLCGNVAGAYHKALMERALRATFREALRSLHSRRRL
DTEKKHQEHLLLSILPAYLAREMKAEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLY
ADIVGFTRLASECSPKELVLMLNELFGKFDQIAKVRGGLPSYPGPFKCPTLESPFQGKLL
TPKIPVPFQSPCIPMEDIPMEVGNPLKQPQEHECMRIKILGDCYYCVSGLPLSLPDHAIN
CVRMGLDMCRAIRKLRAATGVDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHME
AGGVPGRVHITGATLALLAGAYAVEDAAMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTA
GGLLSSLEGPKMRPSVLMTRYLESWGAAKPFAHLSHLESPVSTSTPLPEKTLASFSPQWS
LDRSRTPRGLDDDLDTGDAKFFQVIEQLNSQKQWKQSKDFNPLTLYFREKELEKEYRLSA
LPAFKYYAACTFLVFISNFVIQMLVTNRPPALAITYSITFLLFLLLLFVCFSEHLTRCVL
KGPKMLHWLPTLSGLVATRPGLRIALGTATILLVFVMAVTSLFFLPAASNCPFRVPNVSS
VAFNLSWELPGSLPLISIPYSMHCCVLGFLSCSLFLHMSFELKLLLLLLWLGASCSLFLH
SHAWLSDCLISHLYPDPLDSRPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLW
KKKLRQEQEETETMENLTRLLLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVP
DFKEFYSESNINHEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNAT
SGQDAQQDDERSCSHLGTMVEFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQ
KPQYDIWGNTVNVASRMESTGVLGKIQVTEETAQVLQSLGYTCYSRGIIKVKGKGQLCTY
FLNTDLTRTGPPSATLG
NT seq 3654 nt   +upstreamnt  +downstreamnt
atgaggcttttgcccggacacccctgccggctgggttggagggaggaggagcgagggatg
gcgccggcagcctctcccaggcggctgggaaaaggctgggcggccccagggagcgcgggc
ggacgggcccgcgcgcggcttgaccccagcgagcccggagcggccccggcactaacgcgg
ccccgcgcccgcgcccccagccccgagttcgcgctccgcccgcgcccgcgccgcagccgg
gcagggccgaccatggcgcgcctcttcagcccccggccgccgcccagcgaggacctcttc
tacgagacctactacagcctgagccagcagtacccgctgctgctgctgctgctggggatc
gtgctctgcgcgctcctggccgtgctggctgtggcctcggccagcggcagggatctagcc
tcagacccaggcttcctgatcactgtgctgtgtgcgctcggcggcttctcactgctgctg
ggcctggcatcctgtgagcaacggctacagcgctggacccgtcccctgtccggcctcgtg
tgggcagcgctcctggggctgggccatggcttcctcttcactgggggcctggtgagcgcc
tgggaccaggtgtcctttttcctctttgtcatcttcactgtgtacgccatgttgcccttg
ggtatgcgggatgccaccgccgcgggccttgcctcatcactctcccacctggtggtcctt
gggctgtaccttgggcctcagccggactcccagcccgcgctactgccgcagctggcagca
aacgcggtgctgttcttgtgtgggaatgtggccggagcgtaccacaaggcgctgatggag
cgtgcgctgcgcgccacgttccgggaggcacttcgttcgctgcattcgcgccggcggctg
gacacggagaagaagcaccaggaacaccttcttttgtccatccttcctgcctacttggct
cgagagatgaaggcagagatcatggcccggcttcaggctggacagggatcacggccagag
agcaccaacaacttccatagcctctatgtcaagagacaccaaggagttagcgtgctctat
gctgacatcgtgggcttcacacggctggccagtgagtgctcccctaaggagttggtgctt
atgctcaacgagctctttggcaagttcgaccagattgccaaggtcagagggggcctccct
tcctacccagggcccttcaaatgccccaccctggagagccccttccaagggaaactcctg
acacctaagatcccagtcccatttcagagcccatgtatcccaatggaagatattccaatg
gaagtaggaaaccctctcaaacaaccccaggagcatgaatgcatgcggatcaagatcctg
ggagactgttactactgtgtctctgggctaccgctctccctgccagaccacgccatcaac
tgcgtgcgcatggggctggacatgtgccgggccatcaggaaactccgggcagccaccggt
gtggacatcaacatgcgtgtgggggtgcattcaggcagtgtgctctgcggagtcatcggg
ctgcagaagtggcagtatgatgtctggtcccatgatgtcaccctggccaaccacatggag
gcgggtggcgtgccaggaagagtacatattacaggagctaccctggccctgctggcaggg
gcttatgctgtggaggatgcagccatggaacaccgagacccataccttcgggagctaggg
gagcctacctacctagtcatcgatccccgggctgaggaagaggatgagaagggcactgca
ggagggttgctatcctctctcgagggccccaaaatgcgtccctcagtgctgatgacccgc
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacctagagagcccc
gtgtccacctccacccctctcccggagaagacgctggcctccttcagcccccagtggagc
ctggaccggagccgtaccccccggggactagatgatgacctggacactggggacgccaag
ttcttccaggtcatcgaacagctcaactctcagaaacagtggaagcagtcaaaggacttc
aacccactgacactgtacttcagagagaaggagctggagaaagagtatcgactctctgca
ctccctgccttcaaatactatgcagcctgcaccttcctggttttcatctccaattttgtc
atccagatgctggtgaccaacaggcctccagctctggccatcacctatagcatcaccttc
ctcctcttcctcctcctcctcttcgtctgcttctcagaacacctgacgaggtgtgtcttg
aaaggccccaagatgctgcactggctgcccacactgtctggcttggtggccacccggcct
ggactgcgaattgccctgggcactgccaccatcctcctcgtttttgtcatggctgttacc
agcctgttcttcttaccggcagcatcgaactgtcctttccgggttcccaatgtgtcctcc
gtggctttcaacctctcctgggaactccctgggtccctgcctctcatcagcatcccatac
tctatgcactgctgcgtgctggggttcctgtcctgctccctcttcctgcacatgagcttc
gagctgaagttgctgctgcttctgctgtggctgggggcctcctgctccctcttcctgcac
tcccatgcctggctgtccgactgcctcatctcccacctctatccggatcccttggactcc
aggccaggggtactgaaggagcccaaactgatgggagctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcggcagaatgagtattactgccgcctggacttcctgtgg
aagaagaagctgcggcaggagcaggaggagacagagacaatggagaacctgactcggctg
ctgttggagaatgtgctccctgctcacgtggccccccagttcattggtcagaaccggcgc
aacgaggacctctaccaccagtcctacgagtgtgtctgtgtcctcttcgcctcagttcca
gactttaaggagttttactctgaatccaacatcaaccacgagggtctagagtgcctgcgg
ctgctcaatgagataattgctgattttgatgagcttctctcaaagcccaagtttagtggg
gtggagaagatcaaaaccattggcagcacctacatggcagctacaggcttaaatgccacc
tctggacaggacgcacagcaggatgatgagcgaagctgcagccacctgggcaccatggtg
gagtttgcagtggcccttggatcaaagctggatgtcatcaataagcactcatttaacaac
ttccgcttacgtgtggggttgaaccatggacctgtagtggctggagtgattggggcccag
aagccacagtatgacatctggggcaacacggtgaatgtggccagccgcatggaaagtaca
ggagttctgggcaagatccaagtgactgaagagacagcgcaggtgctgcagtccttaggc
tatacctgctacagccggggcatcatcaaagtcaaaggcaaagggcagctctgcacctac
ttcctgaacacagatttgacacgaactggccctccctcagccaccctaggctga

DBGET integrated database retrieval system