KEGG   Vulpes vulpes (red fox): 112927164
Entry
112927164         CDS       T05911                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112927164 (AKAP5)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     112927164 (AKAP5)
SSDB
Motif
Pfam: WSK NINJA_B
Other DBs
NCBI-GeneID: 112927164
NCBI-ProteinID: XP_025864151
UniProt: A0A3Q7TF84
Position
Unknown
AA seq 428 aa
METTVSEIQVESKDEKRPTEVSPQDERQEERASVLCFKRRKKATKAMKPRASSEAAGAAM
KCPPEAGASDQPQPPGGAWASIKRLVTRRKRSESSKQQKLFEAKVQPEISAEDADLSKKK
AKSGLKIPCIKFSKGEKRSNHSKIIEDSDCSIRVQGEAEHLDTKAAAQSDDQTTKTKLPQ
DVSEEVSRKGGDEICEPKVSNSTTTPGEKVISVELGLDTRHSAVHPGTLILEGDTETIEE
KQSVQPPQASAIETSETEQPPVVSDVLPSPTIPDQQIVEEARSNILESEPNWEEHKSREI
VAEESEPKDTELSQESELRENEVTAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KQFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NKMNNLLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagaccacagtttctgaaattcaagttgaaagcaaggatgagaagagaccaacagaa
gttagtcctcaagatgagaggcaagaggaaagagcatcagtgctttgcttcaagagaaga
aagaaagcaaccaaagcaatgaagcccagggctagctctgaagctgctggggcagcaatg
aagtgtccaccagaagcaggagcttccgatcagccacagcccccagggggtgcctgggcc
tcaatcaaacgtcttgtaacacgcaggaaaaggtcagaatcttcaaagcagcaaaagctc
tttgaggctaaagtacaacctgaaatcagtgctgaggatgctgatctttctaagaaaaag
gcaaaatccggacttaagattccttgcataaaattctcaaaaggagagaaaagaagtaat
cattccaaaattatagaagactcagactgcagcatcagagtccagggagaggctgaacat
ttggatacaaaagctgcagcccaatcagatgaccagacaacaaagaccaagttgccccag
gatgtaagtgaagaggtctcacggaaaggaggtgatgagatctgtgaaccaaaggtgagc
aacagcacaactacacctggagaaaaggtgatttcagtagaacttgggttagataccagg
cattctgctgttcacccaggaactctaatccttgaaggagatactgaaacgattgaggaa
aaacagagtgttcaacccccacaagcaagcgcaattgaaacttcagaaacagaacagcca
ccagtggtttctgatgttcttccctcacctacaatcccagatcagcaaattgtggaagaa
gctagaagcaatatcctagaaagtgaaccaaattgggaagagcacaaaagtagagaaatt
gtagccgaggagagtgagcctaaagatactgaactgagccaggaatctgagctgagagaa
aatgaggtcactgcagagaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattattacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagcaattcttaatttctattgaaaatgagcaagtaggggtttttgctaatgatagtggt
tttgagggtagaacttcagaacagtatgaaacactcttaatagaaacagcttcttctctt
gttaagaatgctatccaattgtctatagaacagctggttaatgaaatggcctctgatgat
aataaaatgaacaatcttctacagtga

DBGET integrated database retrieval system