KEGG   Vulpes vulpes (red fox): 112927166Help
Entry
112927166         CDS       T05911                                 

Gene name
HSPA2
Definition
(RefSeq) heat shock-related 70 kDa protein 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03040  Spliceosome
vvp04010  MAPK signaling pathway
vvp04141  Protein processing in endoplasmic reticulum
vvp04144  Endocytosis
vvp04213  Longevity regulating pathway - multiple species
vvp04612  Antigen processing and presentation
vvp04915  Estrogen signaling pathway
vvp05134  Legionellosis
vvp05145  Toxoplasmosis
vvp05162  Measles
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    112927166 (HSPA2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112927166 (HSPA2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112927166 (HSPA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112927166 (HSPA2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    112927166 (HSPA2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    112927166 (HSPA2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    112927166 (HSPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    112927166 (HSPA2)
  09172 Infectious disease: viral
   05162 Measles
    112927166 (HSPA2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112927166 (HSPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG DUF1464 DDR CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 112927166
NCBI-ProteinID: XP_025864157
UniProt: A0A3Q7TSA1
Position
Unknown
AA seq 637 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEIKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGGGSGASGGPTIEEVD
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcccgcggcccggccatcggcatcgacctgggcaccacgtactcgtgcgtgggg
gtcttccaacacggcaaagtagagatcatcgccaacgaccagggcaaccgcaccaccccc
agctacgtggccttcaccgacacggagcgcctcatcggcgacgccgccaagaaccaggtg
gccatgaaccccaccaacaccatcttcgacgccaagaggctgatcgggcggaagttcgag
gacgccacggtgcaatcggacatgaaacactggccgttccgggtggtgagcgagggaggg
aaacccaaggtgcaggtggagtacaagggagagatcaagaccttcttcccggaggagatc
tcctccatggtcctcacgaagatgaaggagatcgccgaagcctatctggggggcaaggtg
cagagcgcggtcatcacggtcccggcttatttcaatgactcgcagcgccaggccaccaag
gatgcgggcaccatcaccggcctcaacgtgctgcgcatcatcaacgagccgaccgccgcg
gccattgcctacggcctggacaagaaggggtgcgccggcggcgagaagaacgtgctcatc
tttgacctgggcggcggcaccttcgacgtgtccatcctgaccatcgaggacggcatcttc
gaggtgaagtccacagccggcgacacccacctgggcggcgaggacttcgacaaccgcatg
gtgagccacctggccgaggagttcaagcgcaagcacaagaaggacattgggcccaacaag
cgcgcagtgcggcgactgcgcaccgcctgcgagcgcgccaagcgcaccttgagctcgtct
acgcaggcgagcatcgagatcgactcgctgtacgagggcgtggacttctacacgtccatc
acccgcgcccgcttcgaagagctcaacgcggacctcttccgcggaaccctggagccggtg
gagaaggcgctgcgtgacgccaagctggacaagggccagatccaggagatcgtgctggtg
ggcggctccacccgcatccccaagatccagaagctgttacaggatttcttcaacggcaag
gagctgaacaagagcatcaaccccgacgaggcggtggcctacggagccgcggtgcaggcg
gccatcctcatcggggacaagtcggagaacgtgcaggacctgctgctgctcgacgtgacc
ccattgtcgttgggcattgagacggctggcggcgtcatgaccccactcatcaagaggaac
accacgatcccgaccaagcaaacgcagaccttcaccacctactcagacaaccagagcagc
gtgctggtgcaggtgtacgagggcgagcgggccatgaccaaggacaataacctgctgggc
aagttcgacctgaccgggattcccccggcgccccgcggggtcccccagatcgaggtcacc
ttcgacatcgacgccaacggcatcctcaacgtcaccgccgccgacaagagcaccggtaaa
gaaaacaaaattaccattaccaacgacaagggtcgtctaagcaaggacgacattgaccgg
atggtgcaggaggccgagcggtacaagtcggaagatgaagccaatcgcgaccgggtcgcc
gccaaaaacgcggtggagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctcaggggcaagattagcgagcaggacaaaaacaagatcctcgacaagtgtcaggaggtg
atcaactggctcgaccgaaaccagatggcagagaaagacgagtatgaacacaagcagaaa
gagcttgaaagagtgtgcaaccccatcatcagcaaactttaccaaggcggccctggcggc
ggcggcggcggttctggagcctccgggggaccgaccatcgaggaagtggactaa

DBGET integrated database retrieval system