KEGG   Vulpes vulpes (red fox): 112928368Help
Entry
112928368         CDS       T05911                                 

Gene name
BLVRB
Definition
(RefSeq) flavin reductase (NADPH)
  KO
K05901  biliverdin reductase / flavin reductase [EC:1.3.1.24 1.5.1.30]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00740  Riboflavin metabolism
vvp00860  Porphyrin and chlorophyll metabolism
vvp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    112928368 (BLVRB)
   00860 Porphyrin and chlorophyll metabolism
    112928368 (BLVRB)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     112928368 (BLVRB)
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.30  flavin reductase (NADPH)
     112928368 (BLVRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_10 NmrA Epimerase 3Beta_HSD TrkA_N
Motif
Other DBs
NCBI-GeneID: 112928368
NCBI-ProteinID: XP_025865797
UniProt: A0A3Q7TX66
Position
Unknown
AA seq 206 aa AA seqDB search
MAVKKIAIFGATGRTGLTALAQAVQAGYEVTVLVRDASRLPPEGPQPAHVVVGDVLNAAD
VDKTVAGQDAVIVLLGTRNDLSPTTVMSEGTRNIVMAMKAHGVDKVVACTSAFLLWDPSK
VPPHLQAVTNDHIRMHKVLQESGLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHD
LGHFMLSCLTTDKYNGHCTYPSHQYD
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcaagaagattgccatcttcggtgccacgggcaggaccgggctcaccgccctg
gcgcaggcggtgcaagcaggttacgaggtgacagtgctggtgcgggacgcctccaggctg
cccccagaggggccccagccggcccacgtagtagtgggtgacgttctgaatgcggctgat
gtagacaagactgtggccggacaggatgctgtcatcgtgctgctgggcacccgcaatgac
ctcagtcctaccacagttatgtccgagggcacccggaacattgtgatggccatgaaggcc
catggcgtggacaaggtcgtggcctgcacctcggccttccttctgtgggacccgtccaag
gtgcccccacaccttcaggctgtgaccaatgaccacatccggatgcacaaggtgctgcag
gaatcgggcctgaagtatgtggctgtgatgccaccacacataggagaccagccgctgaca
ggggcctacacagtaaccctggatggacgcgggccctccagggtcatctccaaacatgac
ctgggccacttcatgctgagctgcctcaccaccgataagtacaacgggcactgcacctac
ccctcccaccagtacgactag

DBGET integrated database retrieval system