KEGG   Vulpes vulpes (red fox): 112932644Help
Entry
112932644         CDS       T05911                                 

Definition
(RefSeq) alcohol dehydrogenase class-3 isoform X1
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00010  Glycolysis / Gluconeogenesis
vvp00071  Fatty acid degradation
vvp00350  Tyrosine metabolism
vvp00830  Retinol metabolism
vvp00980  Metabolism of xenobiotics by cytochrome P450
vvp00982  Drug metabolism - cytochrome P450
vvp01100  Metabolic pathways
vvp01200  Carbon metabolism
vvp05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112932644
  09103 Lipid metabolism
   00071 Fatty acid degradation
    112932644
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    112932644
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    112932644
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112932644
   00982 Drug metabolism - cytochrome P450
    112932644
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    112932644
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     112932644
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     112932644
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C UDPG_MGDP_dh_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 112932644
NCBI-ProteinID: XP_025871402
UniProt: A0A3Q7UDW6
Position
Unknown
AA seq 374 aa AA seqDB search
MANQVIKCKAAVAWEAGKPLSIEEVEVAPPKAHEVRIKIMATAVCHTDAYTLSGADPEGS
FPVILGHEGAGIVESVGEGVTKLKAGDTVIPLYIPQCGECKFCLNPKTNLCQKIRVTQGK
GLMPDGTSRFICKGKTILHYMGTSTFSEYTVVADISVAKIDPLAPLDKVCLLGCGISTGY
GAALNTAKVEPGSTCAVFGLGGVGLVTIMGRKVAGASRIIGVDINKDKFSRAKVFGASEC
INPQDFSKPIQEVLIEMTDGGVDYSFECIGNVKVMRAALEACHKGWGVSVIVGVAASGEE
ITTRPFQLVTGRVWKGTAFGGWKSVESVPKLVSEYMSRKIKVDEFVTHSLSFDQINEAFD
LLHAGKSIRTVVKL
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccaggttatcaaatgcaaggctgcagttgcctgggaggcaggaaagcctctc
tctatagaagaggtggaggtggcacccccaaaggctcatgaagttcgaattaagattatg
gccactgcagtttgccacaccgatgcctacaccctgagtggggctgatcctgaaggaagt
tttccagtgatcctgggacatgaaggtgctggaattgtggaaagtgttggcgaaggagtt
actaagctgaaagcaggtgacactgtcatcccactttacatcccacagtgtggagaatgc
aaattttgtctaaatcctaaaacaaacctttgccagaaaataagagttacacaggggaaa
ggattaatgccagatggtactagcagatttatttgcaaaggaaagacaattttacattat
atgggaaccagcacattttctgaatatacagttgtggctgatatctctgttgctaaaatt
gatcctttagcacctttggataaagtctgccttctcggttgtggcatttcaactggttat
ggtgctgctctgaacactgccaaggtggagcctggctctacttgtgccgtctttggccta
ggaggagttggattggtgactatcatgggtcgtaaggtggctggtgcatcccggatcatt
ggtgtggacatcaataaagataaattctcaagggccaaggtgtttggagcctctgaatgt
attaacccccaggacttcagtaaacccatccaggaagtgctcattgaaatgactgacggg
ggagtggactattcctttgagtgtattggtaacgtgaaagtcatgagagctgcgctagag
gcctgccacaaaggctggggtgtcagcgtcatagttggagtagctgcttcaggtgaagaa
atcaccactcgtccatttcagctggtaacagggcgcgtatggaaaggcactgcctttgga
ggatggaagagtgtggaaagtgtcccaaagttggtgtctgaatatatgtccagaaagata
aaagttgatgaatttgtgactcacagtctgtcctttgaccaaattaatgaagcctttgac
ctgttgcatgcaggaaagagcattcgaactgttgtaaagctttaa

DBGET integrated database retrieval system