KEGG   Vulpes vulpes (red fox): 112932957Help
Entry
112932957         CDS       T05911                                 

Gene name
PDE10A
Definition
(RefSeq) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A
  KO
K18438  cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10 [EC:3.1.4.17 3.1.4.35]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00230  Purine metabolism
vvp01100  Metabolic pathways
vvp04024  cAMP signaling pathway
vvp05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    112932957 (PDE10A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    112932957 (PDE10A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    112932957 (PDE10A)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     112932957 (PDE10A)
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     112932957 (PDE10A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3 SpoVT_C HD H_kinase_N
Motif
Other DBs
NCBI-GeneID: 112932957
NCBI-ProteinID: XP_025871748
UniProt: A0A3Q7TPT1
Position
Unknown
AA seq 788 aa AA seqDB search
MSNEPAEGSVESCKAAGLTDEKVKAYLSLHPQVLDEFVSESVSTETVEKWLKRKNNKPED
ESAPKEVSRYQDTNMQGVVYELNSYIEQRLDTGGDNQLLLYELSSIIKIATKADGFALYF
LGECNNSLCVFTPPGIKEGKPRLIPAGPIAQGTTISAYVAKSRKTLLVEDILGDERFPRG
TGLESGTRIQSVLCLPIVTAIGDLIGILELYRHWGKEAFCMSHQEVATANLAWASVAIHQ
VQVCRGLAKQTELNDFLLDVSKTYFDNIVAIDSLLEHIMIYAKNLVNADRCALFQVDHKN
KELYSDLFDIGEEKEGKPIFKKTKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREV
DLYTGYTTRNILCMPIVSRGSVIGVVQMVNKISGSAFSKTDENNFKMFAVFCALALHCAN
MYHRIRHSECIYRVTMEKLSYHSICTAEEWQGLMRFNLPVRLCKEIELFHFDIGPFENMW
PGIFVYMVHRSCGTSCFELEKLCRFIMSVKKNYRRVPYHNWKHAVTVAHCMYAILQNNHG
LFTDLERKGLLIACLCHDLDHRGFSNSYLQKFDHPLAALYSTSTMEQHHFSQTVSILQLE
GHNIFSTLSSSEYEQVLEIIRKAIIATDLALYFGNRKQLEEMYQTGSLNLNNQSHRDRVI
GLMMTACDLCSVTKLWPVTQLTANDIYAEFWAEGDEMKKLGIQPIPMMDRDKKDEVPQGQ
LGFYNAVAIPCYTTLTQIFPPTEPLLKACRNNLSQWEKVIRGEESAVWISSPPGAHGPSE
KLPVKIDD
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgagccagcggaaggcagcgtggagtcctgcaaggcagcaggtttgacagat
gaaaaagtgaaggcatatctttctcttcatccccaggtgttagacgagtttgtatctgaa
agtgttagtacagagacagtagaaaaatggctgaagaggaaaaacaacaaaccagaagat
gaatcggctcctaaggaagtcagccggtaccaagatacgaatatgcagggagttgtgtat
gaactaaacagctatatagaacaacggttggatacaggaggagacaaccagctactcctc
tatgaattgagtagcatcattaaaatagccacaaaagctgatggatttgcactgtatttc
cttggagagtgcaataatagtctgtgcgtgttcactccacctggaatcaaagaaggaaag
ccccggctcattcctgctgggcctattgcccagggcaccaccatctctgcctatgtggcc
aagtccagaaaaacattgctagtggaagacatccttggggatgaacggtttccaaggggt
actggtctggagtccgggactcgcatccagtctgttctttgtttaccaattgtcactgca
attggtgatttgattggtatcttggagctctaccggcactggggcaaagaagccttctgt
atgagtcaccaggaggttgcaacagcaaatctcgcctgggcttcagtagcaatacatcag
gtgcaggtgtgcagaggccttgcaaaacaaactgagctgaatgacttcctactggatgtg
tccaagacgtattttgataacatagttgcaatagactctctacttgaacacataatgata
tatgcaaaaaatctggtgaatgccgatcgttgtgcacttttccaggtggaccataagaac
aaggagttatattcagacctttttgatattggagaggaaaaggaaggcaaacctatcttc
aagaagaccaaagaaataagattttcaattgagaaaggaattgctggtcaggtagcaaga
acaggggaagtcctgaacattccagatgcctatgcagatccacgctttaacagagaagta
gacttgtatacagggtacaccacacggaatattctgtgcatgcccatcgtgagtcgagga
agtgtgatcggcgtggtacagatggtgaacaaaataagcggcagtgccttctctaaaacg
gatgaaaacaacttcaagatgtttgccgtcttttgtgcgttagccttacactgtgccaat
atgtaccacagaatccgtcactccgagtgcatttaccgggtgaccatggagaaactgtcc
taccatagcatttgtactgcggaggagtggcagggcctcatgcgcttcaacctccctgtg
cgcctctgcaaagaaattgaattattccactttgatattggtccttttgaaaacatgtgg
cctggaatttttgtctacatggtccatcgttcctgtgggacgtcttgctttgagcttgaa
aagttgtgtcgttttattatgtctgtgaagaaaaactatcggcgggttccttatcacaac
tggaaacacgcagtcaccgtagcacactgtatgtatgccatcctccagaacaaccacggg
ctcttcactgacttggagcgcaaaggactgctaatcgcgtgtctgtgtcatgacctggac
cacaggggcttcagtaacagctacctgcagaaattcgatcaccctctggcagctctctat
tccacctctaccatggagcagcaccacttctcccagaccgtgtccatcctccagttggaa
gggcacaatatcttctccaccctgagctccagtgaatatgaacaggtgcttgagatcatc
cgcaaagccatcattgccacagaccttgctttatactttggaaacaggaaacagttggaa
gagatgtaccagaccggatcgctaaaccttaataatcaatcacatagagatcgtgtcatt
ggtttgatgatgactgcctgtgatctttgttctgtaacaaaactatggccagtgacacaa
ttgacggcaaatgacatatatgcagaattctgggctgagggtgatgaaatgaagaagctg
ggaattcagcctatccccatgatggacagagacaagaaggacgaagtcccacaaggccag
ctgggcttctataacgccgtggccatcccctgctacaccaccctcacccagatcttcccg
cccacagagcctctcctcaaagcatgcaggaataacctcagccagtgggagaaggtgatc
cgaggggaggagagcgcagtgtggatctcatcgccgccaggggcccatgggccctcggag
aagctgcctgtgaagatcgatgactga

DBGET integrated database retrieval system