KEGG   Vulpes vulpes (red fox): 112933963Help
Entry
112933963         CDS       T05911                                 

Gene name
CACNA1I
Definition
(RefSeq) voltage-dependent T-type calcium channel subunit alpha-1I
  KO
K04856  voltage-dependent calcium channel T type alpha-1I
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04020  Calcium signaling pathway
vvp04713  Circadian entrainment
vvp04925  Aldosterone synthesis and secretion
vvp04927  Cortisol synthesis and secretion
vvp04929  GnRH secretion
vvp04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112933963 (CACNA1I)
   04020 Calcium signaling pathway
    112933963 (CACNA1I)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    112933963 (CACNA1I)
   04925 Aldosterone synthesis and secretion
    112933963 (CACNA1I)
   04927 Cortisol synthesis and secretion
    112933963 (CACNA1I)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112933963 (CACNA1I)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112933963 (CACNA1I)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:vvp04040]
    112933963 (CACNA1I)
Ion channels [BR:vvp04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   112933963 (CACNA1I)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans PKD_channel
Motif
Other DBs
NCBI-GeneID: 112933963
NCBI-ProteinID: XP_025873069
UniProt: A0A3Q7T7Q3
Position
Unknown
AA seq 2125 aa AA seqDB search
MAESSPPPSSSSATAPAAEPGVTEQPGPQSPPPSPPGPEEPLDGADPEVPHPDLAPVAFF
CLRQTTSPRNWCIKMVCNPWFECVSMLVILLNCVTLGMYQPCDDMDCLSDRCKILQVFDD
FIFVFFAMEMVLKMVALGIFGKKCYLGDTWNRLDFFIVMAGMVEYSLDLQNINLSAIRTV
RVLRPLKAINRVPSMRILVNLLLDTLPMLGNVLLLCFFVFFIFGIIGVQLWAGLLRNRCF
LEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDV
YDFGAGRQDLNASGLCVNWNRYYNVCRTGSANPHKGAINFDNIGYAWIVIFQVITLEGWV
EIMYYVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQREHRLMLEQRQRYL
SSSTVASYAEPGDCYEEIFQYICHILRKARRRALGLYQALQSRRQASAPGAPTSTKPGPH
TKEPRHYKLCPQHSPLDPTPHTLVQPISAMLASDPASCPRCQHEESRRPSGPDSTDSGQE
GSGSGGSGGGSEEADGDGARSSEDGASSGLGKEDEEEKADGATRLCGDVWRETRAKLRGI
VDSKYFNRGIMMAILVNTVSMGIEHHEQPEELTNILEICNVVFTSMFALEMLLKLAAFGL
FDYLRNPYNIFDSIIVIISIWEIVGQADGGLSVLRTFRLLRVLKLVRFMPALRRQLVVLM
KTMDNVATFCMLLMLFIFIFSILGMHIFGCKFSLRTDTGDTVPDRKNFDSLLWAIVTVFQ
ILTQEDWNVVLYNGMASTSPWASLYFVALMTFGNYVLFNLLVAILVEGFQAEGDANRSYS
DEDQSSSNMEDFDKLQEGLDGSGDPKLCPIPMTPNGHLDPNLPLGGHLGPAGAAAPAPRL
SLQPDPVLVALGSRKSSVMSLGRMSYDQRSLSSSRSSYYGPWGRSGAWASRRSSWNSLKH
KPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRHRHHRR
TLSLDTRDSMDLAELVPAVGAHPRAAWRAVGPAPGHEDCNGRMPSIAKDVFTKMDDRRDR
GEDEEEIDYTLCFRVRKMIDVYKPDWCEVREDWSVYLFSPENRFRVLCQTIIAHKLFDYV
VLAFIFLNCITIALERPQIEAGSTERIFLTVSNYIFTAIFVGEMTLKVVSLGLYFGEQAY
LRSSWNVLDGFLVFVSIIDIVVSVASAGGAKILGVLRVLRLLRTLRPLRVISRAPGLKLV
VETLISSLKPIGNIVLICCAFFIIFGILGVQLFKGKFYHCLGVDTRNITNRSDCVAANYR
WVHHKYNFDNLGQALMSLFVLASKDGWVNIMYNGLDAVAVDQQPWPTPHHPSLNLYFISF
LLIVSFFVLNMFVGVVVENFHKCRQHQEAEEARRREEKRLRRLEKKRRKAQRLPYYATYC
PTRLLIHSMCTSHYLDIFITFIICLNVVTMSLEHYNQPTSLETALKYCNYMFTTVFVLEA
VLKLVAFGLRRFFKDRWNQLDLAIVLLSVMGITLEEIEINAALPINPTIIRIMRVLRIAR
VLKLLKMATGMRALLDTVVQALPQVGNLGLLFMLLFFIYAALGVELFGKLVCNDENPCEG
MSRHATFENFGMAFLTLFQVSTGDNWNGIMKDTLRDCTHDERSCLSSLQFVSPLYFVSFV
LTAQFVLINVVVAVLMKHLDDSNKEAQEDAEMDAELELEMAHGLGPSPRPPSSSPGAPGR
GPGGAGGSGGGDPEGRLCRRCYSPAQENLWLDSVSLIIKDSLEGELTIIDNLSGSIFHHY
SSPAGCEKCHHDKQEVQLAETEAFSLNSDKSSSILLGDDLSLEDPTACPVGPKDSRGEPD
TPEPMQVEEVAECFFPLSNTAVSSDPENFLWEKETVPSNPVRSWLKQESSRAAPPSPFSP
DASSPLLPMPAEFFHPAVSASQKGQDKGPGAGTLPKIALQGSWASLRSPSVNCTLLRQVR
ALPRLQELSWWGTSEWGLEVQVEMEGPVWGMGGLACRASSTALARAASWACRRHGAQSRK
ASRANSPPRGWGSLGSERSRSCPGSHSMVEAEPGLELVHLLTPAMCQAVCQARRPQQATE
YEIPLSWLIRYYSVYALQGCERRDW
NT seq 6378 nt NT seq  +upstreamnt  +downstreamnt
atggctgagagctccccgccgccctcctcctcgtctgccaccgccccagcagctgagccc
ggagtcacggagcagccggggccccagagcccccctccctcccctccaggcccggaggag
cccctggatggagccgatcctgaagtccctcacccggacctggcaccggttgccttcttc
tgtctgcgacagaccaccagcccccggaactggtgcatcaagatggtgtgtaacccatgg
tttgaatgtgtcagcatgctggtgatcctgctgaactgcgtgacacttggcatgtaccag
ccctgcgacgacatggactgcctctccgaccgctgcaagatcctgcaggtatttgatgac
ttcatctttgtcttctttgccatggagatggtgctcaagatggtggccctgggcattttt
ggcaagaaatgctaccttggggacacatggaaccgactggatttcttcatcgtcatggca
gggatggtcgagtactccctggaccttcagaacatcaacctgtcggccatccgcaccgtg
cgtgtcctgaggcccctcaaagccatcaaccgtgtgcccagtatgcggatcctggtgaac
ctcctcctggacacactgcccatgctggggaatgtcctcctcctctgcttctttgtcttc
ttcatcttcggcatcatcggcgtccagctctgggcgggcctgctgcgtaaccgctgcttc
ctggaggagaacttcaccatacaaggggatgtagccctgcccccctactaccagccagag
gaggacgatgagatgcctttcatctgctccctttcgggggacaatggcatcatgggttgc
cacgagatccccccactcaaggagcagggccgcgagtgctgcctgtccaaggatgatgtc
tacgacttcggggcagggcgccaggacctcaatgccagtgggctgtgtgtcaactggaac
cgctactacaatgtgtgccgcacaggcagtgccaacccccacaagggtgccatcaacttt
gacaatatcggttacgcctggatcgtcatcttccaggtgattactctggaaggctgggtg
gagatcatgtactatgtgatggatgctcactccttctacaacttcatctattttatcctg
cttatcatagtgggctccttcttcatgatcaacctgtgcctcgttgtcatagcgacccag
ttctcggagaccaagcagcgggagcaccggctgatgctggagcagcggcagcgctacctg
tcctccagcacggtggccagctacgcggagcccggcgactgttacgaggagatcttccag
tacatctgccacatcctgcgcaaggccaggcgccgcgccctgggtctctaccaggccctg
cagagccgccgacaggcctcggccccgggggcacccacatccaccaaacccgggccccac
accaaggagcccaggcactacaagctgtgccctcaacacagtcccctggacccgacgccc
cacacgctggtgcagcccatctctgccatgctggcctccgaccctgccagctgcccccgc
tgccagcatgaggagagccggcggccctcgggcccggatagcaccgactcgggccaggag
ggctcgggctctggtggctcaggtggcggctcggaggaggccgatggggacggggcccgg
agcagcgaggatggggcctcctcagggctggggaaggaggacgaggaggagaaggcagac
ggggccacccggctgtgtggggatgtgtggcgggagactcgagccaagcttcgaggcatc
gtggacagcaaatacttcaaccggggcatcatgatggccatcctggtcaacaccgtcagc
atgggcatcgagcaccacgagcagcccgaggagctgaccaacatcctagagatctgcaac
gtggtcttcaccagcatgttcgccctagagatgctcctgaagctggctgcctttgggctc
ttcgactacctgcgcaacccttacaacatttttgacagcatcatcgttatcatcagcatc
tgggagatcgtggggcaggcggacggcggcctgtcggtgctgcggaccttccggctgctg
cgggtgctgaagctggtgcgcttcatgcccgcgctgcggcgccagctggtggtgctcatg
aagaccatggacaacgtggccaccttctgcatgctgctcatgctcttcattttcatcttc
agcatccttgggatgcacatctttggctgcaaattcagcctccgtacggacacaggagac
actgtccccgacaggaagaactttgactccttgctgtgggccatcgtcacggtgttccag
attctcacccaggaggactggaacgttgtcctctacaatggcatggcctccacctccccc
tgggcctccctctattttgtcgccctcatgaccttcggcaactacgtgctcttcaacctc
ttggtggccatcctggtggagggcttccaggccgagggtgacgccaatcgctcctactcg
gacgaggaccagagctcatccaacatggaagattttgacaagcttcaggagggcctggat
ggcagtggagatcccaagctctgcccaatccccatgacccccaatgggcacctggacccc
aatctcccgctgggtggacatctgggccctgccggagctgcagcacctgccccccgcctc
tcactgcagccagaccccgtcctggtggccctgggctcccgcaagagcagtgtcatgtca
ctgggcaggatgagttatgaccagcgctccctgtccagctcccggagctcctactacgga
ccgtggggccgcagcggggcctgggccagccgccgctccagctggaacagcctcaagcac
aagccgcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngcaccggcaccgccaccaccgccgg
acactgtccctcgacaccagagactcgatggacctggccgagctggtgcccgccgtgggc
gcccacccccgggcggcctggagggcggtgggcccggcccccgggcacgaggactgcaat
ggcaggatgcccagcatcgccaaggacgtctttaccaagatggatgaccgtcgggatcgc
ggggaggacgaggaggagatcgactacaccctgtgcttccgcgtccgcaagatgatcgac
gtctacaagcctgactggtgcgaggtccgcgaggactggtctgtctacctcttctccccc
gagaacaggttccgagtcctgtgtcagaccatcatcgcccacaagctcttcgactatgtg
gtcctggccttcatctttctcaactgcatcaccatcgccctggagaggccccagatcgag
gctggcagcactgaacgcatcttcctcactgtgtcaaactacatcttcacagccatcttt
gtaggcgagatgacgctgaaggtggtctcgctgggcctgtacttcggggagcaggcctac
ctgcgcagtagctggaatgtgctggacggcttcctcgtcttcgtgtccatcatcgacatc
gtggtttccgtggcctcagcggggggagccaagatcctaggggtccttcgggtcctgcgg
ctcctgcgcaccctacgccccctgcgtgtcatcagccgagctcctggtctgaagctggtg
gtggagacacttatctcttccctcaagcccattggcaacatcgtcctcatctgctgtgcc
ttcttcatcatcttcggcattctgggtgtgcagctctttaagggcaagttctaccactgt
ttgggcgtggacacccgcaacatcaccaaccgctctgactgtgtggctgccaactaccgc
tgggtccaccacaagtacaactttgacaatctgggccaggccctaatgtccctctttgtc
ctggcctccaaggatggctgggtgaacatcatgtacaacggactggacgctgtcgctgtg
gaccagcagccgtggcccacccctcatcatcccagcctgaatctctacttcatctccttc
ctgctcatcgtcagcttctttgtgcttaacatgttcgtgggcgtcgtggtggagaacttc
cacaagtgccggcagcaccaggaggccgaggaggcgcggcggcgcgaggagaagcggctg
cggcgtctggagaagaagcgccggaaggcccagcggctgccctactatgccacctattgt
cccacccggctgctcatccattccatgtgtaccagccactacctggacatcttcatcacc
tttattatctgcctcaatgtggtcaccatgtccctggagcactacaatcagcccacgtcc
ctggagacagccctcaaatactgcaactacatgttcaccactgtatttgtgctggaggct
gtgctgaagctggtggcatttgggctaaggcgcttcttcaaggaccggtggaaccagctg
gacctggccattgtgctgctgtcagtcatgggcatcacgctggaggagattgagatcaac
gcagcactgcccatcaaccccaccatcatccgaatcatgcgggttttgcgcatcgcccgg
gtgctgaagctgttgaagatggccacggggatgcgggccctgctggacacggtggtgcaa
gctctgccccaggtgggcaacctgggccttctcttcatgctgctcttctttatctatgcc
gccctgggcgtggagctctttgggaaactagtctgcaatgacgagaacccatgcgaaggc
atgagccggcatgccaccttcgagaactttggcatggccttcctcacgctcttccaggtc
tccactggcgacaactggaatgggatcatgaaggacacgttgcgggactgcacccatgac
gagcgcagctgcctgagcagcctgcagttcgtgtcgccactgtacttcgtcagcttcgtg
ctcacggcccagttcgtgctcatcaacgtggtggtggccgtgctcatgaagcacctggac
gacagcaacaaggaggcccaggaggacgccgagatggatgccgagctggagctcgagatg
gcccacggcctggggcccagcccgcggccccccagcagctccccgggggcacctggccga
ggcccgggcggggcgggcggcagtggcggtggcgatcccgagggccgtctgtgccggcgc
tgctactctccggcccaggagaacctgtggctggacagcgtctctttaatcatcaaggac
tccttggagggggagctgaccatcattgacaacctgtctggctccatcttccatcactac
tcctcgccggctgggtgtgagaagtgtcaccacgacaagcaagaggtgcagctggccgag
acggaggccttctccctgaactcagacaagtcctcctccatcctgctcggtgatgacctg
agtctcgaggatcccacagcctgcccagtcggccccaaagacagcaggggtgagccagac
acacctgagcccatgcaggtagaagaggtggccgaatgcttcttccccttgtccaacacg
gctgtctcgtcagatcctgagaacttcctgtgggagaaggagacggtcccatccaatccc
gtccggtcctggctgaaacaggagagcagccgagctgcacccccgagtcccttctccccg
gatgcctccagcccgcttctgcccatgcctgcggagttcttccaccctgctgtgtctgcc
agccagaaagggcaggacaagggtcctggcgctgggactctccccaagatcgctctgcag
ggctcctgggcatccctgcggtcgccgagtgtcaactgcaccctcctccggcaggtacgg
gcacttccccgtctccaggagctttcctggtgggggacatctgagtggggccttgaggtc
caggtggagatggaggggccagtctgggggatgggaggtctggcctgcagggccagctct
actgcactggccagggctgcctcctgggcatgcagaaggcacggagcacagagcagaaag
gccagcagagccaacagccccccgcgtgggtggggttccctgggctcagagagaagcagg
agctgccctggctcccacagtatggtggaagcagagccgggcctagagctagtccacctg
ctgaccccagctatgtgccaggctgtgtgccaggctcggaggccacagcaggccacagaa
tacgaaatccccctctcgtggcttatacggtattattcagtgtacgccttgcagggctgc
gagaggagagattggtaa

DBGET integrated database retrieval system