KEGG   Vulpes vulpes (red fox): 112934416
Entry
112934416         CDS       T05911                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112934416 (ANKRD53)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    112934416 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 112934416
NCBI-ProteinID: XP_025873634
UniProt: A0A3Q7T968
Position
Unknown
AA seq 489 aa
MQPAEKVSSRVPLSDSASKQPRAGCPDPDAACRPASPLPTLHSCTLTRPDDAWDQSAIGG
YYELFAAALGNLEWLRFCLSRDHEEIPADDKGFTAIHFAAQSGKLACLQVLVEEYNFPVD
LPTNNGQTPLHLVIHGDNKTMTLPCIHYLLKQGAALNTQTRDGSTPLHMAAFQGLLSCVK
VLVQNGADVHARDATGCKPIDYCKIWNHRDCARFLKDAMWRRDKKDFACEMKKLKRLKDQ
LIFMEQDYLTEYQKEHQILREADFKEWLRCKQPLRGQSLIRNAKPAPGAPPQAITVSKTP
KHKGPPKSFYPSPEARLQQTPALQLQPVGTPTPTYTKPTVRRPKSWNVSNNPARSPTAQI
GYPQGIRLGVHPDPSPDHDFRSFLEVRPDGHGGAQLCTVAGSRVAPVPQLPFEVMVQELY
PSARPYRMRAPQGFRSVSMRDVPQKRHLGDNFWTDTLAMNLRETFDEAFLAAVRTHQGLP
TLPSLKSPP
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgcagccagcagagaaggtctcctccagagtccccctgagtgactcagcgtccaagcag
cccagggcgggctgcccagaccccgacgctgcctgccggcctgcctccccactccccacc
ctccactcctgcaccctcactcgccccgacgacgcgtgggaccagagtgccattgggggc
tactatgagttgtttgccgccgcactgggcaacctggaatggttgcgcttctgtctgagt
cgggaccatgaggaaattccagccgatgacaagggcttcactgccatccactttgcagcc
cagagtggcaagcttgcgtgcctgcaggtcttggtagaggagtacaattttcctgtggac
ctgcccaccaacaatggccagacacccctgcacctggtcatccacggggacaacaagacc
atgaccctcccctgcattcactatctgcttaagcaaggggcggccctcaacactcagaca
cgcgatggctctactcccctccacatggcagccttccaaggcctgctgagctgtgtgaag
gtgctggtgcaaaatggtgccgatgtccatgcccgagatgccacgggctgcaagcccatc
gactactgcaaaatatggaaccaccgcgactgtgcccggttcttgaaggatgcgatgtgg
agacgggacaagaaggactttgcttgtgagatgaagaaactgaagaggctcaaggaccag
ctgatcttcatggaacaggactacctgactgaatatcagaaagagcaccaaattctgaga
gaagccgacttcaaggagtggctccgttgcaagcagccgctccgaggccagtccctgatc
cgcaatgccaagccagcgcctggtgccccaccccaggcgatcaccgtgtccaagaccccc
aagcacaaggggccccccaagagcttctacccctccccggaggcacgcctgcagcagaca
ccagcgctgcagctgcagcccgtggggacacccacacccacgtacacgaaacccacggtc
aggcggcccaagtcgtggaatgtgagcaacaacccagccagatcacccaccgcccagatt
ggctacccacagggcatccgtctgggtgtgcacccagaccccagcccggatcacgacttc
cgcagcttcctggaggtgaggcccgacgggcacggtggggcacaactgtgcacggtggcc
ggcagccgggtggcacctgtgccccagctgcccttcgaggtgatggtgcaagagctgtac
ccttcagcgcggccgtacaggatgagagcgccccagggctttcgctccgtcagcatgagg
gacgtgccccagaagcggcacttgggggacaacttctggaccgacactctggccatgaac
ctgcgcgagacatttgatgaagccttcctggcagctgtgcgaacccatcaagggctcccc
actctgccctccctcaaaagccccccataa

DBGET integrated database retrieval system