KEGG   Vulpes vulpes (red fox): 112935447
Entry
112935447         CDS       T05911                                 

Gene name
AHRR
Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
vvp  Vulpes vulpes (red fox)
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112935447 (AHRR)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    112935447 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 112935447
NCBI-ProteinID: XP_025874951
UniProt: A0A3Q7UAI3
Position
Unknown
AA seq 714 aa
MMIPPGECMYAGRKRRKPIQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVS
KLDKLSVLRLSVSYLRVKSFFQAVQKCPRPPAASAQSPEDGLSGESAVLEGRLLLESLDG
FALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQVV
FGQPLHSETEDAVLGRLLRAQEGGAGSPTDFSAFLTRCFVCRVRCLLDSTSGFLTMQFQG
KLKFLFGQKRKAPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVSASMDA
KAKAAASLCEPELHGKPNYLAGRSDGENISVLRTPTDAGRWARVPARASCLCLRNGPDLV
SNPEGFAGDRGAEEHGRVPRGRREIHAYSCCFEAPGPTRHLSWMPGKHSQEGSTRVKLEP
SKSDPFSMPAVSRTSCVPCPSLPGAIHSSVAAAFRNPPSCHPGSHSPSAYTSPTSRAFRD
SDQGQLHPLPSCPFPQGSLDSGLPPSRGQRLAVAGYPIEDTKFRGGPMPLGAPCNPILSL
DVPIKTESDSGSEDAADGYSVAPGQLWPGATGVAKRQRVTFPTRMHLKTEPDARHHLYAA
HLGQTVLEAHPSGRAPLRAGRDLTPFPPTHCACLEHVHGPPEPDGPCHLCMQAQQPSSLP
CDCQAPESAPIVKREPLDSPPWASHGQGRVPGMFPKSAMATLMPPKAPECAFLP
NT seq 2145 nt   +upstreamnt  +downstreamnt
atgatgattccaccaggggagtgcatgtatgctggaaggaaaagaaggaagcccattcag
aaacagaggcctgccacgggggccgagaagtcaaacccgtccaagcggcaccgcgaccgc
ctcaatgctgagctggaccacctggccagcctgctgccacttcctcctgacatcgtatct
aagctggacaagctttctgtcctgcgtctcagcgtcagctacctcagggtgaagagcttc
ttccaagccgtgcagaagtgcccacggccgccagcggccagtgcccaatccccagaagat
ggtctgagcggagagtccgcggtgctggagggacggctgctgctggagtctctcgatggc
tttgccctcgtcgtgagtgcagaaggcatgatattttatgcgtcagcaacaatcgtggac
tatctgggcttccaccagacggatgtgatgcaccaaaacatttacgactatatccacgtg
gacgaccgccaggacttctgccggcagctccactgggccatggacccgccgcaggtggtg
ttcgggcagcccctgcactcagagacagaggacgctgtcctggggaggctgctgcgcgcg
caggaggggggcgcgggctcgcccacggacttctccgccttcctgacgcgctgcttcgtg
tgccgcgtgcgctgcctgctggacagcacgtcgggcttcctgacaatgcaatttcaagga
aaactaaaattcctgtttggacagaagaggaaagcgccctcggggacagtcctgccccct
cggctctcgctgttctgcatcgtggtgcctgtcctcctaccttctgtggcggagatgaag
atgaagagcgcatttttgagggtgaagcacagggtggacgtctcagcctcaatggatgca
aaagcaaaagctgccgcgagtctgtgtgaaccagaattgcatgggaaacccaactactta
gcagggaggagtgatggagaaaacatctcagtgctcaggacacccacggacgctggccgc
tgggcccgggttccagccagggcctcatgcttgtgtctcaggaatggccctgacctcgtc
tccaatcccgaggggttcgcaggggacaggggagcagaggaacacgggagggtgcccagg
gggcggagggaaatacacgcatacagctgctgcttcgaagcaccgggacccacaaggcac
ctgagctggatgccggggaaacacagtcaggagggcagcaccagggtgaagctggagccc
agcaagagtgacccgttctccatgcctgctgtgtcccgcacttcctgcgtgccctgcccc
agccttccgggtgccatccactccagtgtggctgctgctttcaggaatccacccagctgt
cacccgggaagccattcccccagtgcctacaccagccccaccagcagagcttttcgggac
agtgatcagggccagctgcaccctctgcccagctgccccttcccccaggggagcctggac
agtggtctccctccatccagagggcagcgccttgcagtggcgggctatcccattgaggac
accaagtttcgaggtgggccaatgcccttgggagctccgtgcaaccccattctttccctt
gatgtgcccataaagacagagagtgactctgggtctgaagatgcagccgacggctactct
gtggccccaggccagctgtggccgggagccactggtgtggccaaaagacagcgggtcacg
ttccctaccaggatgcacctgaaaacggagccggacgccaggcaccacctatacgctgcg
cacctgggacagaccgtgctggaggctcacccaagtggccgggctccgctcagagctggc
agagacctgacccccttcccccccacacactgtgcctgcctggagcacgtgcatggccct
cctgagccagatggcccctgccacctctgtatgcaggctcagcagccctcttcactgccc
tgtgactgccaagccccagagtccgcgcccatcgtcaaacgagagcccctggactcaccg
ccatgggccagtcacggccagggtagggtgcctggaatgttccccaaaagtgccatggca
acactgatgccgcccaaagcccctgagtgtgctttcctgccatag

DBGET integrated database retrieval system