KEGG   Vulpes vulpes (red fox): 112935692Help
Entry
112935692         CDS       T05911                                 

Gene name
NLN
Definition
(RefSeq) neurolysin, mitochondrial
  KO
K01393  neurolysin [EC:3.4.24.16]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    112935692 (NLN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112935692 (NLN)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.16  neurolysin
     112935692 (NLN)
Peptidases and inhibitors [BR:vvp01002]
 Metallo peptidases
  Family M3
   112935692 (NLN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M3 NPCBM
Motif
Other DBs
NCBI-GeneID: 112935692
NCBI-ProteinID: XP_025875311
UniProt: A0A3Q7UBH6
Position
Unknown
AA seq 704 aa AA seqDB search
MIARCLPAVRGLHRVGGSKILFMMTLGREVRSPLQAMSSYTVAGRNVLRWDLSPEQIKTR
TEELIVQTKQVYDAIGMLDIEEVTYENCLQALADVEVKYIVERTMLDFPQHVSSDKEVRA
ASTEADKRLSRFDIEMSMREDIFLRIVHLQETSDLSKIKPEARRYLEKSIKMGKRNGLHL
PEQVQNEIKAMKKRVSELCIDFNKNLNEDDTFLVFSKAELGALPDDFIDGLEKTDDDKYK
ITLKYPHYFPVMKKCCIPETRRKMEMAFNTRCKEENTVILQQLLPLRARVAKLLGYSTHA
DFVLEMNTAKSTSHVTAFLDDLSQKLKPLGEAEREFILNLKKKECEERGFEYDGKINAWD
LHYYMTQTEELKYSIDQESLKEYFPIEVVTEGLLNIYQELLGLSFEQVADAHVWHKSVTL
YTVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMSVAALVVNFSQPT
AARPSLLRHDEVRTYFHEFGHVMHQICAQTDFARFSGTNVETDFVEVPSQMLENWVWDMD
SLRRLSKHYKDGSPIMDDLLEKLVDSRLVNTGLLTLRQIVLSKVDQSLHTNTSLDAASEY
AKYCTEVLGVAATPGTNMPATFGHLAGGYDGQYYGYLWSEVFSMDMFYSCFKKEGIMNPE
VGMKYRNLILKPGGSLDGMDMLQNFLKREPNQKAFLMSRGLHAP
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcccggtgccttccggctgtgcgaggcctccacagagttggtggttccaagatt
ttattcatgatgactttaggaagagaagtgaggtctcctcttcaagccatgtcttcctat
actgtggctggcagaaatgttttaagatgggatctttcaccagagcaaattaaaacaaga
actgaggagctcattgtgcaaaccaaacaggtgtacgatgctattggaatgcttgacatt
gaggaagtaacttatgagaactgtttgcaggccttggcagatgtagaggtgaagtacata
gtggagcgaaccatgctagactttcctcagcatgtctcttctgacaaagaagtgcgggca
gcaagtacagaagcagacaaaagactttctcgttttgatattgagatgagcatgagagaa
gatatatttctgagaattgttcatttacaggaaacatctgatctgagtaagataaaacct
gaagccaggagatacttggaaaagtcaattaaaatgggaaaaaggaatgggctccatctt
ccagaacaagttcaaaatgaaatcaaagcaatgaagaaaagagtgagtgagctatgtatt
gacttcaacaaaaacctcaatgaggatgataccttccttgtattttccaaggctgaactt
ggtgcacttcctgatgatttcattgatggtttagaaaagacagatgatgacaagtataaa
attaccttaaaatatccacactattttcctgtcatgaagaaatgttgtatccctgagacc
agaaggaagatggaaatggcttttaatacaaggtgcaaagaggaaaataccgtaatcctg
cagcagctactcccactgcgggccagagtagccaaactccttggctatagcacacatgcc
gactttgtccttgaaatgaacactgcaaagagtaccagccacgtaacagcctttctagat
gacttaagccagaaattaaaaccattgggtgaggcagagcgagaatttattttgaatttg
aagaaaaaggaatgtgaagagagaggttttgaatatgatgggaaaatcaatgcctgggat
ctacattactacatgactcagacagaagaactcaagtactccatcgatcaagagagcctc
aaggaatacttcccaattgaagtggtcactgaaggcttgctgaacatctaccaggagttg
ttggggctttcattcgagcaggtggcagatgctcatgtgtggcataaaagtgtgacactt
tacactgtgaaggacaaagccacaggagaagttttgggacagttctacttggacctctat
ccaagggaaggaaagtacaaccacgcagcctgctttggtctccagcctggctgcctcctg
cctgatgggagccgcatgatgtccgtggctgcccttgtggtgaacttctcacagccaaca
gcagctcgtccctctctcctgaggcatgatgaggtgcggacttacttccacgaatttggt
catgtcatgcatcagatttgtgcacagactgattttgcacgatttagcggaacaaatgtg
gaaaccgactttgtagaggtgccatcacaaatgcttgagaactgggtatgggacatggat
tccctccgaagattgtcaaaacattataaagatggaagccctatcatggatgatctgctt
gaaaaacttgttgattccagactggtcaacacaggtcttctgaccttacgtcagattgtt
ttgagcaaagttgatcagtctctccataccaacacatcgctggacgccgcaagtgaatat
gccaaatactgcacagaggttttaggtgttgcagccaccccaggcacaaatatgccagct
acttttggacatttggcagggggatatgatggccaatattatggatacctttggagtgaa
gtattttccatggacatgttttacagctgttttaaaaaagaaggaataatgaatccagag
gttggaatgaaatacagaaacctaatcctgaaacctgggggatctctggacggcatggac
atgctccagaatttcttgaaacgtgagccaaaccagaaagcgttcctaatgagtagaggc
ctgcatgctccttaa

DBGET integrated database retrieval system