KEGG   Vibrio vulnificus CMCP6: VV1_1358
Entry
VV1_1358          CDS       T00108                                 
Name
(GenBank) Transcriptional (co)regulator CytR
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
vvu  Vibrio vulnificus CMCP6
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvu03000]
    VV1_1358
Transcription factors [BR:vvu03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    VV1_1358
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_38 HTH_AraC HTH_Tnp_ISL3 ClpB_D2-small HTH_Crp_2 MOZART2
Other DBs
NCBI-ProteinID: AAO09809
UniProt: A0A3Q0L3M4
Position
I:complement(1336690..1337697)
AA seq 335 aa
MATMKDVAQLAGVSTATVSRALMNPDKVSATTRKRVEDAVLEAGYSPNSLARNLRRNESR
TIVAIVPDICDPYYTEIIRGIEDAAIEQGYLVLLGDSGQQKRRESSLVNLVFTKQADGML
LLGTDLPFDVSKPEQKNLPPMVMACEFAPDLELPTVHIDNLTSAFEAVNYLTQLGHKRIA
QISGPKSAALCQFRQQGYQQALRRAGITMNPQYCVESEFSFEGGAKAIRHLLEMNDAPTA
VFCHCDTMAIGAIQEAKKLGFRVPQDLSIVGFDDIQFAQYCDPPLTTISQPRYEIGRQAM
LMMLELLKGHDIHSGSRLLETKLVVRGSAAPPGLR
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgacaatgaaggatgttgcccagcttgcaggagtttcaacggcaacggtttcgaga
gcgctgatgaatccagacaaagtatccgccacaacgcgtaagcgtgtggaagatgcagtg
ttggaagctggttattccccaaactcgctggcacgcaatttacgccgcaacgagtcacgc
actatcgtcgcgatcgttcctgacatttgtgatccttactacacagagatcattcgtggc
attgaagatgccgccattgaacagggatatttggttctactcggtgacagcggccaacaa
aagcgccgtgaaagctcactcgtcaatctcgtttttaccaagcaagcggatggtatgctg
ttgctcggtaccgacttaccgtttgatgtgagcaagccagaacagaaaaatcttcctccg
atggtcatggcttgcgagttcgcccccgatctcgaactgccgacggttcatatcgataac
ttgacctcagcatttgaagcggtgaactacctgacccaattgggccacaaacgcatcgcc
caaatttcagggccaaaatccgcagcactttgtcagtttagacaacaaggctatcaacaa
gctttgcgccgtgcaggcatcacaatgaacccacaatactgtgttgagtctgagttctct
tttgaaggtggggcgaaagcgatccgtcatctgctagaaatgaatgacgcgccaactgcc
gttttctgccattgtgacaccatggctatcggggcgattcaagaagcgaaaaaattgggc
ttccgagtaccgcaagatctgtcgattgtcggcttcgatgacattcagtttgcccaatat
tgcgatcctccactaaccaccatctcacagccacgctatgagattggtcgtcaagcgatg
ctgatgatgttagagctgctgaaaggacatgacattcacagtggctcacgcttacttgaa
accaaattggtggttcgtggtagcgcagcgcctccgggcttacgctaa

DBGET integrated database retrieval system