KEGG   Vibrio vulnificus CMCP6: VV1_2098
Entry
VV1_2098          CDS       T00108                                 

Symbol
pflB
Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00620  Pyruvate metabolism
vvu00640  Propanoate metabolism
vvu00650  Butanoate metabolism
vvu01100  Metabolic pathways
vvu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV1_2098 (pflB)
   00640 Propanoate metabolism
    VV1_2098 (pflB)
   00650 Butanoate metabolism
    VV1_2098 (pflB)
Enzymes [BR:vvu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     VV1_2098 (pflB)
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: AAO10486
UniProt: A0A3Q0L503
Position
I:complement(2096424..2098700)
AA seq 758 aa
MAEQFAKAWEGFAAGDWQNEVNVRDFIQKNYTPYEGDESFLVSEGTEATNKLWAKVMEGI
KIENSTHAPVDFDTDLISTITAHDAGYIEKDLETIVGLQTDAPLKRAIIPNGGIRMVEGS
CKVYGRELDPQISKIYSEYRKTHNAGVFDIYTPDILACRKSGVLTGLPDAYGRGRIIGDY
RRVALYGIDFLMKDKLAQFKSLQERFENGEDLQMTMQLREEIAEQHRALGQMKVMAAKYG
YDISRPAETAQEAIQWTYFGYLAAVKSQNGAAMSLGRTSTFLDVYIERDIAAGKITEVEA
QEMIDHFVMKLRMVRFLRTPEYDDLFSGDPIWATESMGGMGLDGRTLVTRSNFRFLNSLY
TMGPSPEPNITVLWSEQLPEGFKKFCAKVSIDTSSIQYENDDLMRPDMNSDDYAIACCVS
PMVVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPVMPKITSEVLSFDEVWNNLDH
FMDWLAKQYVAALNAIHFMHDKYSYESALMALHDRDVYRTMACGIAGLSIAADSLSAIKY
AKVKPIRDEDGVAIDFEIEGDYPKFGNNDARVDDIACELVEVFMNKIRKLKTYRDAVPTQ
SILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDEKGAVASLTSVGKLPFAHAKD
GISYTFSIVPNALGKDENAQRANLAGLMDGYFHHEAGIEGGQHLNVNVLNRDTLLDAVKH
PEKYPQLTIRVSGYAVRFNSLTAEQQADVIARTFTESL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcagagcaatttgctaaagcttgggaaggttttgcagcaggtgactggcaaaacgaa
gtaaacgttcgtgatttcattcagaagaactacactccgtacgaaggcgacgaatctttc
ctagtttctgaaggtactgaagcaaccaacaagctttgggctaaggtaatggaaggtatc
aaaattgagaactcaactcacgctccagttgatttcgatactgacctaatctctaccatc
actgctcacgatgcaggctacattgaaaaagatctagagactatcgttggtctacaaact
gacgcacctctaaaacgcgctatcatccctaacggtggtatccgcatggttgagggttct
tgtaaagtttacggtcgtgaactcgatcctcaaatctctaaaatctactctgaataccgc
aaaacacacaacgctggcgtattcgatatctacactccagatatcctagcttgtcgtaag
tctggtgttctaactggtcttccagacgcttacggccgtggtcgtatcatcggtgactac
cgtcgtgttgcactttacggtatcgacttcctaatgaaggacaaactggctcaattcaag
tctctacaagagcgttttgagaacggtgaagatcttcaaatgactatgcaacttcgtgaa
gagattgctgagcaacaccgcgctctaggtcaaatgaaagtgatggcagcgaaatacggt
tacgatatttctcgcccagctgaaactgcacaagaagctatccaatggacttacttcggc
tacctagcggctgttaagtctcaaaacggtgctgcaatgtctctaggccgtacttctacg
ttcctagacgtgtacatcgagcgtgatatcgctgctggtaagatcactgaagttgaagct
caggaaatgatcgaccacttcgtaatgaaactacgtatggttcgtttcctacgtactcct
gagtacgatgatctattctctggcgacccaatctgggcaacagaatctatgggtggtatg
ggtcttgacggtcgtacgctagtaacgcgttcaaacttccgtttcctaaacagcctatac
acaatgggtccttctccagagccaaacatcactgtactttggtctgagcaactacctgaa
ggcttcaagaagttctgtgcgaaagtatctatcgatacttcttcaatccagtacgaaaac
gacgacctaatgcgtccagacatgaactctgacgactacgcaatcgcatgttgtgtatct
ccaatggttgttggtaagcaaatgcagttcttcggcgctcgtgcaaaccttgcaaaaacg
atgctttacgcaatcaacggtggtgttgatgagaagctgaaaatgcaagttggcccagta
atgcctaagatcacttcagaagtcctaagcttcgacgaagtgtggaacaacctagaccac
ttcatggactggctagcgaagcaatacgttgctgcactaaacgcaatccacttcatgcac
gacaagtacagctatgagtctgcactaatggcactacacgatcgtgatgtttaccgcaca
atggcttgtggtatcgctggtctatctatcgcagctgactcactatctgcaatcaagtac
gcgaaagtgaaaccaatccgtgacgaagatggcgtagctatcgacttcgaaatcgaaggc
gactaccctaaattcggtaacaacgatgctcgcgtagatgacatcgcttgtgaacttgtt
gaagtgttcatgaacaagatccgtaagcttaagacttaccgtgatgctgttcctactcag
tctatcctaactatcacatcaaacgtggtatacggtaagaagacaggtaatacgccagac
ggtcgtcgcgcaggtgctccatttgcaccaggtgcaaacccaatgcacggtcgtgatgag
aaaggtgctgtagcgtctctaacttcagtaggtaaactaccatttgctcacgcgaaagac
ggtatctcttacaccttctctatcgtacctaacgcacttggtaaagatgagaacgctcaa
cgcgctaaccttgctggtctgatggatggttacttccaccacgaagctggcatcgaaggc
ggtcaacacttgaacgtaaacgttctaaaccgtgacacgcttctagacgcagttaagcac
ccagagaagtaccctcagctaactatccgtgtatctggatacgcagttcgctttaactct
ctaactgcagagcaacaagctgacgttatcgcacgtactttcactgaatctctataa

DBGET integrated database retrieval system