KEGG   Vibrio vulnificus CMCP6: VV1_0872Help
Entry
VV1_0872          CDS       T00108                                 

Gene name
gspI
Definition
(GenBank) general secretion pathway protein I
  KO
K02458  general secretion pathway protein I
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu03070  Bacterial secretion system
vvu05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VV1_0872 (gspI)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    VV1_0872 (gspI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvu02044]
    VV1_0872 (gspI)
Secretion system [BR:vvu02044]
 Type II secretion system
  General secretion pathway protein
   VV1_0872 (gspI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T2SSI N_methyl PulG
Motif
Other DBs
NCBI-ProteinID: AAO09375
UniProt: A0A3Q0L2Q0
Structure
PDB: 

Position
I:complement(880218..880580)
Genome map
AA seq 120 aa AA seqDB search
MVRRRKYAGMTLLEVLVALAIFATAAMSVIRAVSQHINTVGYLEQKMFAAMVADNQMAMV
MLNPKNLKASNGEEELAGQTWYWKVAPVATTQPLLKAFDVSVAAEKQASPMITVRSYVAK
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atggttagacgacgcaaatacgcaggcatgaccttgcttgaggtgctggtggcgttggcg
atatttgccactgcggcgatgagcgtgatccgtgccgttagccagcacatcaacaccgtc
ggttatttggagcagaagatgtttgctgccatggtggcagacaatcaaatggcgatggtg
atgctcaaccccaaaaatctaaaagccagcaacggtgaagaagagttagcggggcaaacg
tggtattggaaagtggctcctgtagccacgactcaaccgctgctgaaagcgtttgatgtg
agtgtggcagcagaaaagcaggccagcccaatgattacggtgagaagctatgtggcgaaa
taa

DBGET integrated database retrieval system