KEGG   Vibrio vulnificus CMCP6: VV1_1226Help
Entry
VV1_1226          CDS       T00108                                 

Definition
(GenBank) Phosphoribosylamine--glycine ligase
  KO
K01945  phosphoribosylamine---glycine ligase [EC:6.3.4.13]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00230  Purine metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01130  Biosynthesis of antibiotics
Module
vvu_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VV1_1226
Enzymes [BR:vvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.13  phosphoribosylamine---glycine ligase
     VV1_1226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GARS_A GARS_N GARS_C ATP-grasp_3 CPSase_L_D2 ATP-grasp ATP-grasp_4 RimK ATP-grasp_2 Dala_Dala_lig_C
Motif
Other DBs
NCBI-ProteinID: AAO09684
UniProt: Q8DD07
Position
I:complement(1205003..1206292)
Genome map
AA seq 429 aa AA seqDB search
MNVLIIGSGGREHALGWKAAQNPNVETIFVAPGNAGTALEPKLENVNIAVEDIAGLVAFA
KEKAIELTIVGPEVPLVLGVVDAFYEAGLPIFGPTQAAAQLEGSKAFTKDFLARHQIPTA
AYANFTDIEPALAYVREQGAPIVVKADGLAAGKGVIVAMTLEEAEEAIKDMLAGNAFGEA
GSRVVIEEFLDGEEASFIVMVDGENVLPMATSQDHKRVGDKDTGPNTGGMGAYSPAPVVT
PEIHNRVMQEVIFPTVRGMAAEGNPYTGFLYAGLMIDKDGTPKVIEYNCRFGDPETQPIM
MRMESDLVELCLAAIDKKLDQVESKWDPRASIGIVLAAGGYPAAYNKGDVISGLPQVEIE
GEKVFHAGTENKEGDIVTNGGRVLCATALGNSVSEAQQRAYELAKQIRWEGMFHRNDIGY
RAIAREQQK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtattgataattggttccggcggtcgtgaacacgctctaggttggaaagccgcg
caaaaccccaatgtggagacaatcttcgtcgcgccgggtaacgctggtaccgcacttgag
cctaagctagaaaacgtcaacatcgccgttgaagacattgccggtttagtggcgtttgct
aaagagaaagccattgaactgaccatcgtcggtcctgaagtgccactcgtactgggtgtc
gttgatgcgttttatgaagcaggcctgccaatttttggccctacccaagcggctgcgcaa
cttgaaggctctaaagcatttaccaaagacttccttgctcgtcaccaaatcccgacggcg
gcgtacgcaaactttacggacatcgagccagcactggcctatgtacgtgaacaaggcgcg
ccaatcgtggtgaaagcagatggccttgcggcaggtaaaggcgtgattgtcgcgatgacg
ctggaagaagcggaagaagcaatcaaagacatgctcgcaggcaacgcctttggcgaggca
ggcagccgcgtggtgatcgaagagttccttgatggcgaagaagcgagcttcatcgtgatg
gtggatggcgaaaacgtactgccaatggccaccagccaagaccacaagcgtgtcggcgat
aaagacaccggtccaaacaccggcggtatgggcgcttactcacccgcaccagtggtgaca
ccagagatccataaccgtgttatgcaagaggtgatcttccctaccgtgcgtggcatggca
gccgaaggtaacccatacacgggcttcctctatgccggcttgatgattgacaaagatggc
acaccaaaagtgatcgagtacaactgccgctttggtgacccagaaacgcaacctatcatg
atgcgcatggaatcggatcttgtggaattgtgcctcgcggccatcgacaagaaactggat
caagtcgagtccaagtgggaccctcgcgcatcgatcggtattgtgcttgcagcgggtggc
tatccagcggcgtacaacaagggcgacgtgatctctggcctacctcaagttgaaattgaa
ggcgaaaaagtcttccacgctggcactgaaaataaagagggcgatatcgtaacaaacggt
ggtcgtgttctttgtgccaccgcactgggcaacagcgtatcagaagcgcagcaacgcgcg
tacgagctggcaaaacagatccgttgggaaggcatgttccaccgcaacgatattggctac
cgtgctatcgctcgcgagcaacaaaaataa

DBGET integrated database retrieval system