KEGG   Vibrio vulnificus CMCP6: VV1_1253Help
Entry
VV1_1253          CDS       T00108                                 

Definition
(GenBank) Copper sensory histidine kinase CpxA
  KO
K07640  two-component system, OmpR family, sensor histidine kinase CpxA [EC:2.7.13.3]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu01503  Cationic antimicrobial peptide (CAMP) resistance
vvu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VV1_1253
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    VV1_1253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvu01001]
    VV1_1253
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vvu02022]
    VV1_1253
Enzymes [BR:vvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VV1_1253
Protein kinases [BR:vvu01001]
 Histidine kinases
  OmpR family
   VV1_1253
Two-component system [BR:vvu02022]
 OmpR family
  CpxA-CpxR (envelope stress response)
   VV1_1253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CpxA_peri HATPase_c HisKA HAMP HATPase_c_3 DUF2547
Motif
Other DBs
NCBI-ProteinID: AAO09709
UniProt: A0A3Q0L3H0
Position
I:complement(1237957..1239345)
Genome map
AA seq 462 aa AA seqDB search
MRLPKITSLYGRIFAIFWFTMFLVLMAVLALPHLDPRKARNIPADQYDRFIEAKQEIEKQ
YRGETDLGRILFRMERPGDRHGRDGRPRFFITDYDGNILTTLKQGDFQLKALKNFVTSIE
QPDQPKQKLYGRFMLSGPLPVTLANKEYLLYVGMRWNQPPPFLLRMFDHPFQLLLAVMLV
STPLLLWLAWALSQPARRLEKAAQRVAKGEFVTDPSLEKGTSEFRQAGASFNRMVEAVNQ
MISGQQRLLSDISHELRSPLTRLRMANALATRKQGESNELQRIDTEAQRLEQMISELLEL
SRMQMNSHLDREEQPVASLWEEIIQDAQFEAEQMGKVLQYTPLPERHISGNPKLLMSAIE
NIIRNAIYYGKDQVIIAIQAIDDTLHIVVDDNGEGVPEEELEAIFRPFYRVSTARDRHSG
GTGLGLSITESAIRQHSGTINAERSDLGGLRVTITLPLVKRR
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgccgaaaatcaccagtttgtatgggcgaatttttgcgatcttctggtttacc
atgtttttggtgctgatggccgtcttggctttgccccaccttgatcctcgtaaggcacgc
aatattccggccgatcaatacgatcgctttattgaagccaagcaggagatcgagaagcaa
tatcgtggcgaaactgatcttggtcgcattctctttcgcatggagcgccccggcgatcgc
catgggcgagatggccggccgcgctttttcatcaccgattacgatggcaatatcctcacc
accttgaagcaaggggattttcaactcaaggcgctgaaaaacttcgtcacctcgattgaa
caacccgatcaaccgaaacaaaaactctatggccgctttatgctctcagggccactgcca
gtgacgctagcgaacaaagagtacttactttacgttgggatgcgctggaaccaaccaccg
ccttttttactgcgtatgtttgatcatccatttcagctactactggctgtgatgctggtc
agtacccctttactgctgtggctagcgtgggcactcagccaacccgcacgacgcttagaa
aaagcggcgcaacgtgtcgctaaaggggaatttgtcacggatccctctttagaaaaaggt
acctcggagtttcgccaagccggcgccagcttcaaccgcatggtcgaagcggtcaatcag
atgatttcaggtcagcaacggttgctgtcggatatttcccatgaactgcgctcgccacta
acccgcttgagaatggccaatgcgcttgcgacacgcaaacagggcgaaagtaatgagctg
caacgaattgataccgaagcgcaacgtttggaacagatgatcagtgaactgctggagctg
tctcgcatgcagatgaacagccatttggatcgtgaagagcagcccgtcgccagcctatgg
gaagagatcattcaagatgcacaatttgaagcggaacaaatgggcaaagtattgcaatac
accccgttacccgagcgacatatttccggtaatcctaagctgttgatgagcgcgatcgaa
aacatcattcgcaatgccatctactacggcaaagaccaagtgatcatcgctattcaagcc
atcgacgacacactacatatcgtggtggatgataatggtgaaggggtacctgaagaggaa
ctcgaagccattttccgtccgttttatcgagtctctaccgctcgggatcgtcattctgga
ggaaccgggctcggcttaagcatcaccgaaagcgcgattcgtcagcacagcggcaccata
aacgctgagcgcagcgatcttggcggtttgcgagtcaccattactcttccactggtgaaa
aggcgttaa

DBGET integrated database retrieval system