KEGG   Vibrio vulnificus CMCP6: VV1_1257Help
Entry
VV1_1257          CDS       T00108                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00010  Glycolysis / Gluconeogenesis
vvu00030  Pentose phosphate pathway
vvu00051  Fructose and mannose metabolism
vvu00052  Galactose metabolism
vvu00680  Methane metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
vvu01230  Biosynthesis of amino acids
vvu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:vvu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_1257 (pfkA)
   00030 Pentose phosphate pathway
    VV1_1257 (pfkA)
   00051 Fructose and mannose metabolism
    VV1_1257 (pfkA)
   00052 Galactose metabolism
    VV1_1257 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    VV1_1257 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    VV1_1257 (pfkA)
Enzymes [BR:vvu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VV1_1257 (pfkA)
Protein phosphatases and associated proteins [BR:vvu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     VV1_1257 (pfkA)
Messenger RNA biogenesis [BR:vvu03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     VV1_1257 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: AAO09713
UniProt: Q8DCY1
Position
I:1242051..1243013
Genome map
AA seq 320 aa AA seqDB search
MIKKIGVLTSGGDAPGMNAAIRGVVRTALGAGLEVYGIYDGYLGLYEGRIKQLDRSSVSD
VINRGGTFLGSARFPEFKEVAVREKAIENLKAHGIDALVVIGGDGSYMGAKKLTEMGYPC
IGLPGTIDNDIAGTDYTIGYLTALNTVIESIDRLRDTSSSHQRISIVEIMGRHCGDLTLM
SAIAGGCEYIITPETGLDKEKLIGNIQDGISKGKKHAIIALTELMMDANELAKEIEAGTG
RETRATVLGHIQRGGRPTAFDRVLASRMGNYAVHLLMEGHGGRCVGIVKEQLVHHDIIDA
IENMKRPVRNDLFKVAEELF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaagatcggtgttttgacaagtggtggtgacgcccctggtatgaacgcagca
atccgtggtgtggtacgtactgcactgggtgctggtcttgaagtttatggtatctatgat
ggctacctaggcttgtacgaaggccgtattaaacaacttgatcgttcaagcgtttctgat
gtgattaaccgtggtggtacgttcttgggatcagctcgtttcccagaatttaaagaagtt
gcggtacgtgaaaaagcgattgaaaacctaaaagcacacggtattgatgcgcttgtggtt
atcggcggcgacggttcgtacatgggtgcgaagaaactgactgaaatgggttacccatgt
atcggtctaccaggcacgattgacaacgatatcgcaggtacggattacaccatcggttac
ctaacggcgctgaacacggttatcgaatcgatcgaccgtctacgcgatacttcatcttct
caccagcgtatttctatcgtagaaatcatgggtcgtcactgtggtgacctcactctgatg
tctgctatcgcaggtggctgtgaatacatcatcacaccagaaactggcctagataaagag
aagctgattggcaacatccaagacggcatttctaaaggtaagaaacatgcgatcatcgcg
ctgactgagctgatgatggacgcgaacgaactggcaaaagagatcgaagcgggaacgggt
cgtgaaactcgtgccacggttcttggtcacatccaacgtggtggccgtccaacggcgttc
gaccgtgttcttgcgtctcgtatgggtaactacgcggttcacctattgatggaaggtcat
ggtggccgttgtgttggtatcgtgaaagagcaacttgttcaccacgacatcatcgatgca
atcgagaacatgaagcgtccagttcgcaatgatctgttcaaagtagcagaagagctattc
taa

DBGET integrated database retrieval system