KEGG   Vibrio vulnificus CMCP6: VV1_1349Help
Entry
VV1_1349          CDS       T00108                                 

Gene name
glpX
Definition
(GenBank) fructose-1,6-bisphosphatase, class II
  KO
K02446  fructose-1,6-bisphosphatase II [EC:3.1.3.11]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00010  Glycolysis / Gluconeogenesis
vvu00030  Pentose phosphate pathway
vvu00051  Fructose and mannose metabolism
vvu00680  Methane metabolism
vvu01100  Metabolic pathways
vvu01110  Biosynthesis of secondary metabolites
vvu01120  Microbial metabolism in diverse environments
vvu01130  Biosynthesis of antibiotics
vvu01200  Carbon metabolism
Module
vvu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VV1_1349 (glpX)
   00030 Pentose phosphate pathway
    VV1_1349 (glpX)
   00051 Fructose and mannose metabolism
    VV1_1349 (glpX)
  09102 Energy metabolism
   00680 Methane metabolism
    VV1_1349 (glpX)
Enzymes [BR:vvu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     VV1_1349 (glpX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AAO09802
UniProt: A0A3Q0L3G8
Position
I:complement(1330590..1331597)
Genome map
AA seq 335 aa AA seqDB search
MKRDLAMAFSRVTEGAALAGYKWLGRGDKNAADGAAVEVMRTLLNKTDISGEIVIGEGEI
DDAPMLYIGENVGLGGDEVDIAVDPIEGTRMTAMGQSNALAVLAAGEKGSFLKAPDMYME
KLVVGPGAKGVIDLNKPLKENLVNIAQALGKTLDTLVVITLAKPRHDEVIAEMQRMGVRV
FAVPDGDVAASILTCMPDSEVDVMYCIGGAPEGVVSAAVIRALDGDMHGRLLPRNEVKGD
NEENRKFADFELERCAEMGVEANKVLKLEDMARSDNVIFSATGITKGDLLEGISRQGNIA
TTETLLIRGRCRTIRRIKSIHYLERKDDEVKAIIL
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcgatttagcgatggccttttcccgcgtcacagaaggcgctgctctagcgggt
tataaatggctaggccgtggtgacaaaaacgcggcggatggcgctgcagtagaagtcatg
cgcaccctgctgaataaaaccgacatcagtggcgaaattgttattggtgaaggtgaaatc
gacgatgccccgatgctttacattggcgaaaatgttggcctaggtggtgatgaagtggat
atcgcggtcgatccaatcgaagggacgcgcatgaccgcgatgggccaatcaaacgctctt
gcggtactggctgccggtgaaaaagggagctttttaaaagcaccggatatgtacatggaa
aaactggtggttggccctggtgcaaaaggagtgatcgatctcaacaagccacttaaagaa
aacctcgtgaacatcgcacaagcgcttggaaaaacgcttgataccttggtggtgattacc
cttgcaaagcctcgtcatgatgaggtgatcgccgagatgcaacgcatgggtgttcgtgtt
ttcgctgtgccggatggtgatgtggccgcttcgattcttacctgcatgccagacagtgaa
gttgacgtgatgtactgtattggtggtgcacctgaaggggttgtctcagcggccgtcatt
cgcgcattggatggcgacatgcatggtcgtcttttaccccgtaacgaagtaaaaggcgat
aacgaagaaaaccgcaagtttgcggatttcgagctcgagcgctgcgctgaaatgggcgtg
gaagcgaacaaagtgctaaaactggaagacatggcacgcagtgataacgtcattttctcc
gcaacaggcatcactaaaggcgatctacttgaaggcatcagccgtcaaggcaatattgca
accactgaaacattgctgattcgtggccgttgtcgaacaattcgtcgtatcaagtcgatt
cattatcttgagcgcaaagatgacgaagtgaaagcgatcattctttaa

DBGET integrated database retrieval system