KEGG   Vibrio vulnificus CMCP6: VV1_3028Help
Entry
VV1_3028          CDS       T00108                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00450  Selenocompound metabolism
vvu00970  Aminoacyl-tRNA biosynthesis
vvu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    VV1_3028
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    VV1_3028
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:vvu01007]
    VV1_3028
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vvu03016]
    VV1_3028
Enzymes [BR:vvu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     VV1_3028
Amino acid related enzymes [BR:vvu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   VV1_3028
Transfer RNA biogenesis [BR:vvu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    VV1_3028
 Prokaryotic type
   Other AARSs
    VV1_3028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f PhnA_Zn_Ribbon FeoC
Motif
Other DBs
NCBI-ProteinID: AAO11352
UniProt: Q8D8F2
Position
I:3091531..3093603
Genome map
AA seq 690 aa AA seqDB search
MANDPRNFPQRKLLVTCALPYANGSIHLGHMLEHIQADIWVRYQRLRGNIVNFICADDAH
GTPIMLKAQQMGMSPEEMIAAVSIEHQKDFAGFDISFDNYHSTHSDENRELASHIYLQLK
KNGFISSRTISQLFDPEKEMFLPDRFVKGTCPKCKSEDQYGDNCDACGETYSPTELINPK
SAVSGATPVMKDSEHFFFDLPQFESMLKEWTRSGSLQTETANKMQEWFESGLQQWDISRD
APYFGFEIPGEKDKFFYVWLDAPIGYMGSFKNLCDKRDDLDFDEYWNKDSKTELYHFIGK
DIVYFHSLFWPAMLDGSGFRKPNNVFVHGYVTVNGAKMSKSKGTFVKASTYLEHLDPECL
RYYYAAKLNSRIDDLDLNLEDFTQRVNADVVNKIVNLASRNAGFIAKRFEGKLAENFVEP
ELYNEFVAAADRIAELYEAREFGRAIRELTALADKANQYVDEKAPWVVAKQEGKDQELQE
ICSVGINLFRVLMTYLKPVMPALAARTEAFLNEELTWEGVAQPLTAHEITAFKALFNRID
PKNIEAMIEASKEDAAAEMAAKEKAEASNAAQETELSKDPIAEEIEFDDFAKVDLRIAKI
VSCESVPKADKLLKFQLDIGGEMRQVFSGIKAAYNPEDLVGKYTVVVANLKPRKMKFGMS
EGMILAAGPGGKDLWILEPHEGAQPGMRVM
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgatccaagaaactttccccaaaggaaattgctggtaacttgtgcccttccg
tacgctaacggttcgatccaccttggccatatgcttgagcatatccaagcggacatttgg
gttcgttaccaacgcctacgcggcaacattgtaaacttcatctgtgctgacgacgctcac
ggcacgccaattatgcttaaagcgcaacagatgggtatgtctccagaagagatgattgct
gcggtgagcatcgagcaccaaaaagatttcgctggctttgatattagtttcgataactat
cacagcacgcattccgatgagaaccgtgagctggcgtctcacatttatctgcaactgaaa
aaaaatggctttatttcaagccgtactatttctcagttgttcgaccctgaaaaagagatg
ttcctacccgatcgtttcgtgaagggaacgtgtccgaagtgtaagtctgaagatcaatac
ggcgacaactgcgatgcttgtggcgaaacctacagcccaacagaattgatcaatccaaaa
tctgccgtctcaggcgcaacgccagtgatgaaagattcagagcacttcttcttcgacctg
cctcagtttgaaagcatgctaaaagagtggactcgctctggctctctgcaaactgaaacc
gcaaataaaatgcaagaatggtttgagtctggtctgcagcagtgggatatctcacgtgat
gcaccttacttcggttttgaaattccaggcgaaaaagacaagtttttctacgtttggcta
gatgcgccaatcggctacatgggttcattcaaaaacctatgtgataagcgtgatgatctt
gattttgatgaatactggaataaagacagtaaaacagaactttaccacttcatcggtaaa
gacatcgtttacttccacagcctgttctggccagcaatgctagacggctctggcttccgt
aagccaaacaacgtttttgttcacggctacgtaaccgtaaatggtgcgaagatgtcgaag
tctaaaggtacattcgtgaaagcgagcacttaccttgagcaccttgatccagagtgtctg
cgttactactacgcagcgaagctaaacagccgcattgatgacctagaccttaaccttgaa
gactttactcagcgcgtaaacgctgacgtcgtaaacaagattgttaacctagcatcgcgt
aatgcgggcttcattgcgaaacgctttgaaggcaagctcgctgaaaacttcgtcgagcca
gagctttacaacgaatttgttgccgcagcagaccgtattgctgaactttacgaagcgcgt
gagttcggtcgtgcgatccgtgaactcaccgcgttggcggacaaagctaaccaatacgtt
gatgaaaaagcgccttgggttgtggcaaaacaagaaggcaaagatcaggaacttcaggaa
atctgttctgttggtattaacctgttccgcgttctaatgacttacttgaagccagttatg
cctgctcttgcagctcgcactgaagccttcttgaatgaagagctaacctgggaaggtgtt
gctcagccattaacagcacacgaaattactgcgtttaaagcgctattcaatcgtatcgat
ccgaaaaacatcgaagccatgattgaagcatcaaaagaagatgcggcggctgaaatggcg
gcaaaagagaaagcagaagcctctaatgcagctcaagagaccgagctaagcaaagatccc
attgccgaagaaattgagtttgatgacttcgcgaaagtggaccttcgtattgccaaaatc
gtttcttgtgaatcggtgccaaaagctgacaaactgttgaaattccaattggatatcggc
ggtgaaatgcgtcaagtcttctctggtatcaaagcggcgtacaatcctgaagatcttgtc
ggcaagtacacagtggttgtggcaaacttgaaaccacgtaagatgaagtttggtatgtct
gagggcatgatcctagcggcaggccctggtggcaaagatctttggatccttgaaccacat
gaaggcgcgcagccaggcatgcgcgtgatgtaa

DBGET integrated database retrieval system