KEGG   Vibrio vulnificus CMCP6: VV2_0216Help
Entry
VV2_0216          CDS       T00108                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu00670  One carbon pool by folate
vvu01100  Metabolic pathways
vvu01120  Microbial metabolism in diverse environments
vvu01200  Carbon metabolism
Module
vvu_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VV2_0216
Enzymes [BR:vvu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     VV2_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: AAO07187
UniProt: Q8D7D8
Position
II:complement(245895..247643)
Genome map
AA seq 582 aa AA seqDB search
MLSDIDICRTTPLKPIEQIAAKAGLLADEFETHGLYKAKVSARCVKRLAEQQDGKLVLVT
AITPTPLGEGKTVTTIGLAQGLQSLNQSVMACIRQPSMGPVFGVKGGAAGGGYSQVAPMD
ELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRAGYQAFEARTGLPALRIDPDRVVWKRV
MDHNDRALRKVRVGINDEGKTINGFEREEGFDISAASELMAILALSKNLQDMRERIGKVV
LAYNLDSEPVSAEQLQVAGAMTVTLKEAIKPTLMQTLEGVPTLIHAGPFANIAHGNSSII
ADEIALKLSSYVVTEAGFGSDMGLEKACNIKSSTSHKAPDCVVIVATLRGLKANSGLYDL
KPGMPLPDALFQPDRAALESGFSNLKWHIDNAQKYGLPVVVAINQFPQDSAEELGQLKLW
IQQLPLNVRVAISEGFAKGGKGMEAVAREVIEACDAPANFRPLYRAEQTLEEKIITVCTK
GYGCGEVQFSDTAKQQLALYQTLGFGELAVCMAKTPLSISSDSSLKGAPSGFTIMVREVR
LCAGAGFVYALTGNVMTMPGLPDIPAFMALDIDENGDIVGLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctttcagatatcgatatttgtcgtacgacacctcttaaaccaattgaacagattgcc
gcaaaagcaggactgctggcagatgagtttgaaactcacggtttatataaagcgaaagtg
tctgcccgatgtgtaaaacgccttgctgagcaacaagatggcaaacttgttttggtcacg
gcaatcacaccaaccccacttggagaaggcaaaaccgtcaccactatcggtctagcgcaa
gggttacaaagcctcaatcaatcggtgatggcgtgtatccgtcaaccttctatggggcct
gtttttggtgtaaaagggggcgctgcgggtggtggctattcacaggtcgccccgatggat
gaacttaatttgcatcttactggcgacattcacgccgttactgcggcgcacaatctcgcc
gcagctgccattgatgcccgcatctatcacgaacagcgcgctggttatcaagcctttgaa
gctcgcaccgggcttcctgcattaagaattgacccagatcgcgtggtttggaaacgcgta
atggaccacaacgatcgcgcactgcgtaaagttcgcgttggaatcaatgacgaaggcaag
accatcaacggatttgaacgtgaagaaggctttgatatttcagccgcatctgaactgatg
gcaattttggcgttgtcgaaaaaccttcaagatatgcgtgaacgtattggtaaagtggtt
ctcgcttacaatctggatagcgaacctgtcagtgcagaacagttacaagtggcaggtgcg
atgacagtaacgctgaaagaagcgatcaaaccgacgctgatgcaaacgcttgaaggtgtg
cctacccttattcatgcgggtccatttgctaacattgcacacgggaactcatccatcatc
gctgatgagattgccttaaaactgtcgagttacgttgtcaccgaggccggttttggctca
gatatggggcttgaaaaagcatgcaacatcaaatcttcaacttcgcacaaagcccccgat
tgcgtggtgattgttgcgactttgcgcggtttgaaagcaaactcagggctgtatgaccta
aaacctggtatgccattaccagacgccttatttcaaccggatcgcgctgcgctggaatcc
ggctttagtaacctaaaatggcatattgataacgcgcaaaaatacggtttaccagtggtc
gttgctatcaatcagtttccacaagacagcgcagaggagcttgggcaactcaagctttgg
atccagcaactgccactcaatgttcgtgtcgcgatcagcgagggctttgccaaaggtggt
aaaggcatggaggcggtagctcgtgaagtgattgaagcatgtgatgcgccagcaaacttt
cgcccactgtatcgagcagagcaaacgctcgaggagaaaatcatcaccgtttgtactaaa
ggttacggttgtggtgaggtgcaatttagcgataccgcaaaacagcagttagctctttat
caaacattaggatttggcgagttggccgtgtgtatggcaaaaacccccctttctatctcg
tccgattcctctctcaaaggtgcaccaagtggatttaccatcatggtccgtgaagttagg
ctctgtgctggcgcgggtttcgtttacgcgctcactggtaatgtgatgactatgccaggt
ctgccagacatccccgcttttatggcactggatatcgatgaaaatggcgatattgttggc
ctaagctaa

DBGET integrated database retrieval system