KEGG   Vibrio vulnificus CMCP6: VV2_0427Help
Entry
VV2_0427          CDS       T00108                                 

Definition
(GenBank) hypothetical protein
Organism
vvu  Vibrio vulnificus CMCP6
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PAAR_motif DUF4150
Motif
Other DBs
NCBI-ProteinID: AAO07381
UniProt: A0A3Q0KY06
Position
II:complement(460250..460540)
Genome map
AA seq 96 aa AA seqDB search
MGKPASVIGCFHVCPKKTGKIPHVGGPVVTGSPNVKIGGIPAAREGDKLICVGPPDSISS
GSSSVKINGKPAARMGDSTSHGGKILVGVPTVLIGD
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaacctgcatctgtcattggttgttttcacgtctgtccgaaaaagaccgggaag
attccccatgttggaggccctgtcgtcacgggctcgccgaatgtgaaaataggaggtata
cctgccgcgagagaaggagacaagctgatatgtgttggccctcccgacagtatttcaagc
ggttcatcgtcagtaaaaattaacggcaagccagccgctcggatgggtgatagcacttct
cacggtggcaaaatattggttggcgtacctaccgtgttgattggagattag

DBGET integrated database retrieval system