KEGG   Vibrio vulnificus CMCP6: VV2_0429
Entry
VV2_0429          CDS       T00108                                 

Definition
(GenBank) Hemolysin-coregulated protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vvu  Vibrio vulnificus CMCP6
Pathway
vvu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VV2_0429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvu02044]
    VV2_0429
Secretion system [BR:vvu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VV2_0429
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AAO07383
UniProt: A0A3Q0KY10
Position
II:complement(462440..462919)
AA seq 159 aa
MQSNTYLKYADIKGEATAEQYKDMITLLSVDWSVGREISSYTGTAMDREASSTRLYDMTI
TKLQDKASPDLFKEATIGKGKPAVFHITKQGEKIEEIMKIQLTDAMISNYAVSIQDDRPI
ETITISYTEMMMTVTPTDDKNNTSAPLVYGYSGVKGQQM
NT seq 480 nt   +upstreamnt  +downstreamnt
atgcagtcaaatacctacctgaaatatgctgatattaaaggtgaagctaccgcagaacag
tacaaggatatgattactcttctttcagttgattggagtgtaggtcgtgaaatttcttct
tatactggtaccgcaatggatcgtgaagcaagctctactcgtctttacgatatgaccatt
accaaacttcaagacaaagcatccccagatctgttcaaagaagccacgattggtaagggt
aaacccgctgtattccatatcactaagcagggtgaaaaaatcgaagaaatcatgaaaatt
caactaacggatgccatgatttctaactatgcagtgtcaattcaagacgaccgtccaatt
gaaacaatcaccatctcttacacagagatgatgatgactgtgacgcctactgatgacaaa
aacaacacatctgctccgttggtatacggttacagcggtgttaaaggtcaacaaatgtaa

DBGET integrated database retrieval system