KEGG   Vibrio vulnificus CMCP6: VV2_0435
Entry
VV2_0435          CDS       T00108                                 

Definition
(GenBank) Uncharacterized protein ImpD
  KO
K11899  type VI secretion system protein ImpD
Organism
vvu  Vibrio vulnificus CMCP6
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvu02044]
    VV2_0435
Secretion system [BR:vvu02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   VV2_0435
SSDB
Motif
Pfam: VipB VipB_2 NDUFA12
Other DBs
NCBI-ProteinID: AAO07389
UniProt: A0A3Q0KY35
Position
II:complement(469785..471278)
AA seq 497 aa
MNFIEIEQLSHDLPTPESALENGIWMAHFLDAKTMTQMVSYWVEISGAKTKQEFVHSIIS
AIESIDREVSAQLDEILHHRQMQKLEATWRGLNYLVQQKDHNAGELVKVKVLSCTWEELK
KDSERAIEFDQSALFKLVYQNEYSMPGGEPFGLLIGDYYLCGGQNAMVVEREINILRKIA
QSAAAAFSPFIMSVEPSVFGSDYFENIASMTNVYAQFEQNEYVSWKRLRAEEDVRFIGLT
LPNLLYRQPYQSDGSRSDSFVYNERVRDSHQDLLWGNAAYSFAAVIVRAFQEHGWFTHIR
GHKTGDYSQGIIQPPSLCQVDLPGKGGRYRAPLNLKITEKREQELADCGFIPLSPVAETP
FVSFTSNISLHKPQQFASKGASVNARLSSMLQYTLCVSRIAHYLKVMGRDRIGSYQDAQS
IERDFQAWLHKYTTASDEASDELRAKYPLNEAKIKVTEKLGSPGKYYSVIHLRPHFQLDQ
MVSSIKLITELSPEHIV
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaatttcatcgaaattgagcaactttcccacgatttaccgacaccagagtctgctttg
gagaatggtatttggatggcgcattttcttgatgccaagacgatgacgcagatggtgagc
tattgggttgagatttctggagcgaaaacgaaacaagagtttgttcacagcatcatcagt
gccattgaatcgattgatagggaagtgagcgctcaactggatgagattcttcatcaccga
caaatgcaaaagcttgaagcgacgtggcgaggcttaaattaccttgtgcagcagaaagat
cacaatgccggagagcttgtaaaggtcaaagtcctatcttgtacatgggaagagctgaag
aaagacagtgagcgagcgatagagttcgatcaatccgcgctgtttaagttggtctatcaa
aacgaatactcgatgccagggggagagccgtttggtttattgattggcgactattatctc
tgtggcggtcaaaacgccatggtggttgaaagagaaatcaacatattaaggaaaattgcg
cagtcggcagcagcggcgtttagccctttcattatgtcggtcgaaccgagtgtttttggt
tcagattactttgaaaacatcgcgtcgatgacgaacgtctatgcccaatttgagcaaaat
gaatacgtgagttggaaacgactacgagccgaagaagatgttcggtttattggtttaacg
ctacccaaccttttgtatcgtcagccatatcaaagtgacggctcgagatcggattcgttt
gtttataacgaacgagttcgagattcgcaccaagatttgttgtggggaaatgccgcctat
tcctttgccgcggtcattgttagagcatttcaagagcatggttggtttacacacatacgt
ggacataaaacaggggactactctcaaggcattatccagcctccttctttatgtcaggtt
gatttaccaggaaagggagggcgatatcgcgcacctctcaacttaaaaataacggaaaaa
agagagcaagagttggcagattgtggatttatccctctgtctcccgtcgctgaaacgccg
tttgttagctttacgtcgaacatctctttgcacaaacctcagcagtttgcttccaaggga
gcgagtgtaaatgcacgtttgtcttcgatgttgcaatacaccttatgtgtttcaagaatt
gctcactatttaaaagtgatgggaagagatcggattggcagctatcaagatgcccaatcg
atagaacgagattttcaggcgtggcttcataaatataccactgcgtctgatgaggcttcg
gatgaactgagagcaaaatatccgcttaacgaagccaaaataaaagtcactgaaaagcta
ggtagcccaggaaaatattattcggtgatccacctacggccccattttcaactggatcaa
atggtttcatcgatcaagttgattacggagttgtctcctgagcatattgtataa

DBGET integrated database retrieval system