KEGG   Vibrio vulnificus CMCP6: VV2_0436
Entry
VV2_0436          CDS       T00108                                 

Definition
(GenBank) Uncharacterized protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
vvu  Vibrio vulnificus CMCP6
Brite
KEGG Orthology (KO) [BR:vvu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvu02044]
    VV2_0436
Secretion system [BR:vvu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VV2_0436
SSDB
Motif
Pfam: VipB VipB_2 CBX7_C
Other DBs
NCBI-ProteinID: AAO07390
UniProt: A0A3Q0KY41
Position
II:complement(471323..472816)
AA seq 497 aa
MTTQLETQLDPTVEGQSFSFLEQAIGATKQTEASRAEELIKTLTEEALKGTVTWNKNLTV
TFREAITALDKKISEQLSAVMHHPELQKLEGTWRGLNYLVMNSETSSTLKIRMVSMTKKE
LHKDLSKAVEFDQSQVFKKVYESEFGSAGGEPYGAIIGDYEFTNHPEDIETLRLMSNVAA
AGFSPFLSAASPALFGFDEWTELSKPRDLEKVFESLEYTQWRAFRESQDSRFVSLTMPKV
LARLPYGQATSPVEEFGFEEFSVDETTGIAVNAQHNDYCWMNSSYVLGAKLTDAFAKYGF
CTAIRGAEGGGRVDNLPTHFFMSDDGDPDMKCPTEIGITDRRESELGKLGFLPLCHYKNT
NYAVFFGAQTCQKPAKYDSPDATANAAISARLPYMMATSRFAHYLKVMARDKIGSFMEAE
DVESWLNRWILGYVNASEGGGQEIRAKYPLADARVQVREVPGAPGAYNAVAWLKPWLQME
ELTTSLRLVAKIPQSGG
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacaacacagcttgaaacacaattagaccccaccgttgaaggccagagtttttccttc
ttagaacaagcgattggcgcgaccaaacaaacggaagcgtcgagagcagaagagttaatc
aaaacattaacagaagaagctttaaaaggtacggtaacgtggaataaaaacctaaccgtg
acgtttcgtgaagccattaccgctttggacaaaaagatttccgaacagctgtctgcggtg
atgcatcaccctgagttgcaaaagttggaaggaacgtggcgtgggttgaattatctggtg
atgaattcggaaacgagctccacgttaaagattcgtatggtgagtatgaccaagaaagag
ctgcacaaagatttgagtaaagcagtggagttcgatcaaagccaggtctttaagaaagtc
tacgaatcagaattcggtagtgctggtggtgagccatatggtgcgatcattggtgactat
gaatttacgaatcatccagaagatattgaaacgctgcgtcttatgtcgaatgttgcggca
gctggtttttctccattcctttctgccgcctcacctgcgttgtttggttttgacgaatgg
acggaattgtcgaagcctagagatttagagaaagtatttgagtcgctcgagtacactcag
tggcgcgcattccgtgaaagccaagactcacgctttgtcagcttgacgatgccgaaagtc
cttgctcgacttccttatggacaagcgacatcgccagtcgaagagtttggttttgaagag
ttttccgtagacgaaaccaccggaattgccgtgaatgcgcagcacaacgactactgctgg
atgaactcgtcgtatgtactgggagcgaagctcactgacgcatttgccaagtatggattc
tgcacggcaattcgtggtgctgagggtggtggtcgtgtcgacaatctgccaacgcacttc
tttatgagtgacgatggcgatccagatatgaaatgcccgaccgaaattggcattactgac
cgtcgtgaatccgagttaggtaaactgggcttcctgcctttatgtcactataagaatacc
aactacgctgtattctttggtgcgcaaacctgccaaaaaccagccaaatacgattcgcca
gatgccactgcgaatgctgcgatttctgcgcgcttgccttacatgatggcgacttctcgt
tttgcgcattatctcaaggtcatggcgcgagataagattggtagcttcatggaagcagaa
gacgttgagtcatggctaaatcgatggatccttggctacgtcaacgcgtcggaaggcggt
ggtcaagagatccgtgcgaaatacccgttggcggatgcgcgagtgcaggtcagagaagtt
cctggcgcaccgggtgcttacaacgcggtcgcgtggcttaagccttggctgcaaatggaa
gagctcacaacgtctctccgtttggtagcgaaaatccctcagtctggcggataa

DBGET integrated database retrieval system