KEGG   Vibrio vulnificus YJ016: VV2342
Entry
VV2342            CDS       T00150                                 

Name
(GenBank) formate acetyltransferase
  KO
K00656  formate C-acetyltransferase [EC:2.3.1.54]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00620  Pyruvate metabolism
vvy00640  Propanoate metabolism
vvy00650  Butanoate metabolism
vvy01100  Metabolic pathways
vvy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VV2342
   00640 Propanoate metabolism
    VV2342
   00650 Butanoate metabolism
    VV2342
Enzymes [BR:vvy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.54  formate C-acetyltransferase
     VV2342
SSDB
Motif
Pfam: PFL-like Gly_radical
Other DBs
NCBI-ProteinID: BAC95106
UniProt: Q7MJ21
Position
I:2368706..2370982
AA seq 758 aa
MAEQFAKAWEGFAAGDWQNEVNVRDFIQKNYTPYEGDESFLVSEGTEATNKLWAKVMEGI
KIENSTHAPVDFDTDLISTITAHDAGYIEKDLETIVGLQTDAPLKRAIIPNGGIRMVEGS
CKVYGRELDPQISKIYSEYRKTHNAGVFDIYTPDILACRKSGVLTGLPDAYGRGRIIGDY
RRVALYGIDFLMKDKLAQFKSLQERFENGEDLQMTMQLREEIAEQHRALGQMKVMAAKYG
YDISRPAETAQEAIQWTYFGYLAAVKSQNGAAMSLGRTSTFLDVYIERDIAAGKITEVEA
QEMIDHFVMKLRMVRFLRTPEYDDLFSGDPIWATESMGGMGLDGRTLVTRSNFRFLNSLY
TMGPSPEPNITVLWSEQLPEGFKKFCAKVSIDTSSIQYENDDLMRPDMNSDDYAIACCVS
PMVVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPVMPKITSEVLSFDEVWNNLDH
FMDWLAKQYVAALNAIHFMHDKYSYESALMALHDRDVYRTMACGIAGLSIAADSLSAIKY
AKVKPIRDEDGVAIDFEIEGDYPKFGNNDARVDDIACELVEVFMNKIRKLKTYRDAVPTQ
SILTITSNVVYGKKTGNTPDGRRAGAPFAPGANPMHGRDEKGAVASLTSVGKLPFAHAKD
GISYTFSIVPNALGKDENAQRANLAGLMDGYFHHEAGIEGGQHLNVNVLNRDTLLDAVKH
PEKYPQLTIRVSGYAVRFNSLTAEQQADVIARTFTESL
NT seq 2277 nt   +upstreamnt  +downstreamnt
atggcagagcaatttgctaaagcttgggaaggttttgcggcaggtgactggcaaaacgaa
gtaaacgttcgtgatttcattcagaagaactacactccgtacgaaggcgacgaatctttc
ctagtttctgaaggtactgaagcaaccaacaagctttgggctaaggtaatggaaggtatc
aaaattgagaactcaactcacgctccagttgatttcgatactgacctaatctctaccatc
actgctcacgatgcaggctacattgaaaaagatctagagactatcgttggtctacaaact
gacgcacctctaaaacgcgctatcatccctaacggtggtatccgcatggttgagggttct
tgtaaagtttacggtcgtgaactcgatcctcaaatctctaaaatctactctgaataccgc
aaaacacacaacgctggcgtattcgatatctacactccagatatcctagcttgtcgtaag
tctggtgttctaactggtcttccagacgcttacggccgtggtcgtatcatcggtgactac
cgtcgtgttgcactttacggtatcgacttcctaatgaaggacaaactggctcaattcaag
tctctacaagagcgttttgagaacggtgaagatcttcaaatgacgatgcaacttcgtgaa
gagattgctgagcaacaccgcgctctaggtcaaatgaaagtgatggcagcgaaatacggt
tacgatatttctcgcccagctgaaactgcacaagaagctatccagtggacttacttcggc
tacctagcggctgttaagtctcaaaacggtgctgcaatgtctctaggccgtacttctacg
ttcctagacgtgtacatcgagcgtgatatcgctgctggcaagatcactgaagttgaagct
caggaaatgatcgaccacttcgtaatgaaactacgtatggttcgtttcctacgtactcct
gagtacgatgatctattctctggcgacccaatctgggcaacagaatctatgggtggtatg
ggtcttgacggtcgtacgctagtaacgcgttcaaacttccgtttcctaaacagcctatac
acaatgggtccttctccagagccaaacatcactgtactttggtctgagcaactacctgaa
ggcttcaagaagttctgtgcgaaagtatctatcgatacttcttcaatccagtacgaaaac
gacgacctaatgcgtccagacatgaactctgacgactacgcaatcgcatgttgtgtatct
ccaatggttgttggtaagcaaatgcagttcttcggcgctcgtgcaaaccttgcaaaaacg
atgctttacgcaatcaacggtggtgttgatgagaagctgaaaatgcaagttggcccagta
atgcctaagatcacttcagaagtcctaagcttcgacgaagtgtggaacaacctagaccac
ttcatggactggctagcgaagcaatacgttgctgcactaaacgcaatccacttcatgcac
gacaagtacagctatgagtctgcactaatggcactacacgatcgtgacgtttaccgcacg
atggcttgtggcatcgctggtctatctatcgcagctgactcactatctgcaatcaagtac
gcgaaagtgaaaccaatccgtgacgaagatggcgtagctatcgacttcgaaatcgaaggc
gactaccctaaattcggtaacaacgatgctcgcgtagatgacatcgcttgtgaacttgtt
gaagtgttcatgaacaagatccgtaagcttaagacttaccgtgatgctgttcctactcag
tctatcctaactatcacatcaaacgtggtatacggtaagaagacaggtaatacgccagac
ggtcgtcgcgcaggtgctccatttgcaccaggtgcaaacccaatgcacggtcgtgatgag
aaaggtgctgtagcgtctctaacttcagtaggtaaactgccatttgctcacgcgaaagac
ggtatctcttacaccttctctatcgtacctaacgcacttggtaaagatgagaacgctcaa
cgcgctaaccttgctggtctgatggatggttacttccaccacgaagctggcatcgaaggc
ggtcaacacttgaacgtaaacgttctaaaccgtgacacgcttctagacgcagttaagcac
cctgagaagtaccctcagctaactatccgtgtatctggatacgcagttcgctttaactct
ctaactgcagagcaacaagctgacgttatcgcacgtactttcactgaatctctataa

DBGET integrated database retrieval system