KEGG   Vibrio vulnificus YJ016: VV3013
Entry
VV3013            CDS       T00150                                 
Name
(GenBank) transcriptional regulator
  KO
K05499  LacI family transcriptional regulator, repressor for deo operon, udp, cdd, tsx, nupC, and nupG
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvy03000]
    VV3013
Transcription factors [BR:vvy03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    VV3013
SSDB
Motif
Pfam: Peripla_BP_3 Peripla_BP_1 LacI Peripla_BP_4 HTH_38 HTH_AraC HTH_Tnp_ISL3 ClpB_D2-small HTH_Crp_2 MOZART2
Other DBs
NCBI-ProteinID: BAC95777
UniProt: Q7MH59
Position
I:3095049..3096056
AA seq 335 aa
MATMKDVAQLAGVSTATVSRALMNPDKVSATTRKRVEDAVLEAGYSPNSLARNLRRNESR
TIVAIVPDICDPYYTEIIRGIEDAAIEQGYLVLLGDSGQQKRRESSLVNLVFTKQADGML
LLGTDLPFDVSKPEQKNLPPMVMACEFAPDLELPTVHIDNLTSAFEAVNYLTQLGHKRIA
QISGPKSAALCQFRQQGYQQALRRAGITMNPQYCVESEFSFEGGAKAIRHLLEMNDAPTA
VFCHCDTMAIGAIQEAKKLGFRVPQDLSIVGFDDIQFAQYCDPPLTTISQPRYEIGRQAM
LMMLELLKGHDIHSGSRLLETKLVVRGSAAPPGLR
NT seq 1008 nt   +upstreamnt  +downstreamnt
atggcgacaatgaaggatgttgcccagcttgcaggagtttcaacggcaacggtttcgaga
gcgctgatgaatccagacaaagtatccgccacaacgcgtaagcgtgtggaagatgcggtg
ttggaagctggttattccccaaattcgctggcacgcaatttacgccgcaacgagtcacgc
actatcgtcgcgatcgttcctgacatttgtgatccttactacacagagatcattcgtggc
attgaagatgccgccattgaacagggatatttggttctactcggtgacagcggccaacaa
aagcgccgtgaaagctcactcgtcaatctcgtttttaccaagcaagcggatggtatgcta
ctgcttggtaccgacttaccgtttgatgtgagcaagccagaacagaaaaatcttcctccg
atggtcatggcttgcgagttcgcccccgatctcgaactgccgacggttcatatcgataac
ttgacctcagcatttgaagcggtgaactacctgacccaattgggccacaaacgcatcgcc
caaatttcagggccaaaatccgcagcactttgtcagtttagacaacaaggctatcaacaa
gctttgcgccgtgcaggcatcacaatgaacccacaatactgtgttgagtctgagttctct
tttgaaggtggggcgaaagcgatccgtcatctgctagaaatgaatgacgcgccaaccgcc
gttttctgccattgtgacaccatggctatcggggcgattcaagaagcgaaaaaattgggc
ttccgagtaccccaggatctgtcgattgtcggcttcgatgacatccagttcgcccaatat
tgcgatcctccactaaccaccatctcacaaccacgctatgagattggtcgtcaagcgatg
ctaatgatgttagagctgctgaaagggcatgacattcacagtggctcacgcctacttgaa
accaaattggtggttcgtggtagcgcagcgcctccgggcttacgctaa

DBGET integrated database retrieval system