KEGG   Vibrio vulnificus YJ016: VV0380Help
Entry
VV0380            CDS       T00150                                 

Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy03010  Ribosome
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    VV0380
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:vvy03011]
    VV0380
Ribosome [BR:vvy03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    VV0380
  Bacteria
    VV0380
  Archaea
    VV0380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: BAC93144
UniProt: Q7MPI3
Position
I:387065..387397
Genome map
AA seq 110 aa AA seqDB search
MEAIAKHNFARISPQKARLVADLIRGKSVDQALEILTFSNKKAAVLVKKVLESAIANAEH
NEGADIDDLNVAKIFVDEGPTMKRIMPRAKGRADRILKRSSHITVVVADR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagctattgctaaacataactttgctcgcatttcgcctcagaaagctcgcttagtt
gcggatctaattcgtggtaaatctgttgaccaagctcttgaaatcctaactttcagcaac
aaaaaagctgctgtactagttaagaaagttctagagtctgctatcgctaacgcggagcac
aacgaaggtgcagatattgacgatctgaatgtcgcaaaaatctttgtagatgaaggccca
accatgaagcgtattatgcctcgtgctaaaggtcgtgcggatcgtatcttgaagcgttca
agccacatcactgttgttgtagcagatcgctag

DBGET integrated database retrieval system