KEGG   Vibrio vulnificus YJ016: VV0477Help
Entry
VV0477            CDS       T00150                                 

Definition
(GenBank) apaG protein
  KO
K06195  ApaG protein
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VV0477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: BAC93241
UniProt: Q7MP87
Position
I:complement(461193..461573)
Genome map
AA seq 126 aa AA seqDB search
MDVSQPRIQIQVHTKYVEEQSNPELARYIFAYIITIKNHSSESVQLLSRRWLITDANGKQ
ISVEGDGVVGQQPFIDAGDEYTYSSGTALDTPVGVMQGQYIMHDAQGKEFVVEIEPFRLA
VPNILN
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atggacgtatctcaaccccgtatccaaattcaagttcacaccaaatacgtcgaagaacaa
tccaatcctgaacttgctcgctatatcttcgcttacatcattaccattaaaaaccacagt
tcagagagcgtgcaactgcttagtcgacgctggttgatcaccgatgccaatggcaaacag
atctctgtcgaaggcgatggcgtcgtcggccaacaaccgtttatcgacgctggtgatgag
tacacttacagcagtggcaccgcattagacaccccagttggcgtcatgcaaggtcaatac
atcatgcacgacgctcaaggcaaagaatttgtcgtcgaaatcgagcctttccgcctcgcg
gttcccaacattctcaactga

DBGET integrated database retrieval system