KEGG   Vibrio vulnificus YJ016: VV1129Help
Entry
VV1129            CDS       T00150                                 

Definition
(GenBank) putative multidrug resistance protein
  KO
K03296  hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    VV1129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACR_tran MMPL
Motif
Other DBs
NCBI-ProteinID: BAC93893
UniProt: Q7MME3
Position
I:1136474..1139587
Genome map
AA seq 1037 aa AA seqDB search
MLLSDVSVKRPVAALVLSLLLCVFGFVSFSKLAVREMPDIESPVVSISTRYDGASATIIE
SQITSVLEDQLSGISGIDEISSTTRNSMSRITITFELGYDLNTGVSDVRDAVARAQRSLP
EEADDPIVFKNNGSGEASVYINLSSSEMDRTQLTDYIERVLMDRFSLITGVSSVDISGGL
YKVMYVKLSPELMAGRGVTATDITAALRSENLESPGGQVRNDQTVMSVRTARSYNSVEDF
QYLVVKRASDNTPIYLKDVADVFIGAENENSTFKSDGVVNVSMGIVPQSDANPLEVAKRV
HEEVDKVQKFLPEGTRLAIDYDSTVFIERSISEVYSTLFITGGLVILVLYIFIGQARATL
IPAVTVPVSLISSFIAAYYFGFSINLITLMALILSIGLVVDDAIVVVENIFHHIEKGESP
LLAAYKGTREVGFAVIATTLVLVMVFLPISFMDGMVGLLFTEFSVLLAMSVIFSSLIALT
LTPVLGSKILKANVKKNRFNDVVDVLFGKLESGYRALLKRALAWRWLAPVIILACMGGSY
ALMNQVPAQLTPQEDRGVIFAFVRGADATSYNRMSANMDLVEERLMPLLGQGFLKSFSIQ
SPAFGGQAGDQTGFVIMILDDWNERSVTAQQALGEVRKALAGIPDVRVFPFMPGFRGGSS
EPVQFVLGGSDYNELRDWAEVLKNKAEESPIMEGAEINYSEKTPELVVSVDKRRAAELGI
SIKEISDTLEIMLGGRKETTFVERGEEYDVYLRGDENRFNNAADLSQIYLRTKSGDLVTL
DTVTNVEEIASSIRLSHYNKQKAITITANLSDGYTLGDALDFLDQQAIETLPGDITISYS
GESKDFKENQSSVAIVFALALLVAYLVLAAQFESFINPLVVMFTVPMGVFGGFLGLLIMQ
QGMNIYSQIGMIMLIGMVTKNGILIVEFANQLRDRGFEFEQAIIDASARRLRPILMTAFT
TLAGAIPLILSDGAGYESRVAVGTVIFFGMGFATLVTLFVIPAMYRLISRYTEAPGHVEA
ELNQALSHDTKGRVSHG
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgttactctctgatgtctcggtgaaaaggccagttgctgcgctggtattgagtttgttg
ctgtgtgtgtttggttttgtctcgttcagcaaattggcggtgcgcgagatgccggacatc
gaaagcccagttgtctccattagtacgcgttacgatggggcgtcggcgacgatcatcgaa
agccagatcacgtcagtgcttgaagatcaactctcaggcatcagtggtattgatgagatt
tcgtcaaccacgcgtaacagcatgtcacgtatcaccattacctttgaattgggttatgac
ctcaatactggggtgagtgatgttcgtgatgcagttgcgcgagcgcagcgttcgctaccc
gaggaagccgacgatcctatcgtgtttaaaaacaacggtagcggtgaggcatccgtttac
atcaacctcagctcgtcagagatggatcgtactcagctcaccgattacatcgagcgtgta
ctcatggatcgctttagtcttatcaccggagtgagttcagttgatatctcgggtggcttg
tacaaagttatgtacgtaaagctaagtcctgagctgatggccggacgaggtgtgactgcc
acggacattaccgccgcgctgcgcagtgagaaccttgaaagtccgggggggcaagtgcgg
aacgatcaaacggtgatgtctgttcgcaccgcgcgcagctataactcagtagaagacttc
caatatctggtggtcaagcgtgccagtgacaacacgccgatttatctcaaagacgtggcg
gatgtctttattggtgctgagaatgagaactcgacgtttaaaagtgacggggtagtcaac
gtcagcatggggattgtccctcagtcggacgccaacccgcttgaggttgcaaaaagagtg
catgaagaagtcgataaagtgcagaagtttttgccagaagggacacgtctcgccatcgac
tacgattcaaccgtgtttattgaacgctctatttctgaagtttatagcactctgttcatc
actggcgggctcgtgatcctcgtgctgtatatcttcatcggtcaagctcgcgcgactttg
atcccagcggtgaccgtgcctgtgtcgctgatttcctcttttattgccgcgtactacttt
ggtttctcgattaacctcatcaccttaatggctttgattctctctatcggtttggtggtc
gacgatgcgattgttgtcgttgagaacattttccatcatatcgagaaaggtgaatcgcct
ttgcttgcggcctataaaggcacgcgagaggtaggctttgcggtcattgccaccacctta
gtgttggtgatggtgtttttgccgatctccttcatggatggcatggtgggcctactcttt
accgagttctcggtgttgctggcgatgtccgtgattttttcatcattgattgcgctgacg
ctcacccccgtcttaggcagcaaaattctcaaagccaatgttaagaaaaaccgcttcaat
gacgtcgtagacgtgttgttcggcaagttagagtccggttatcgcgcgttgctaaagcga
gccctcgcatggcgatggcttgcgcccgtgatcatccttgcctgtatgggcggcagctac
gcgctaatgaatcaagtgccagcacaattaacaccacaagaagatcgtggggtcattttt
gcctttgtccgtggcgccgatgccaccagttacaaccgcatgtctgccaatatggactta
gtggaagagcgtttaatgccgctgttagggcaagggttcctcaaatcattcagcatccag
tcgccggcgtttgggggccaagcgggtgaccaaaccggattcgttattatgatcttggat
gattggaatgaacgttcggtgacagcgcaacaagcgttaggcgaagtgcgtaaggcgctg
gcgggcattcctgatgtccgtgttttcccgtttatgcccggattccgtggtggttcgagt
gagcctgtgcagtttgtgcttggcggctcggattacaacgaactgcgcgattgggccgag
gtgctaaagaacaaagcggaagaatccccaattatggaaggggcggagatcaactattct
gagaaaacgccggaactggtggtgtcggtggacaaacgtcgtgccgcagaactgggcatc
agcatcaaagagatttccgataccttagaaatcatgttgggtgggcgtaaagaaaccacc
tttgtggagcgtggtgaagagtacgatgtttatcttcgtggtgatgaaaatcgctttaat
aacgcagcagatctgagccaaatctatctgcgcacaaaaagtggcgatctggttacctta
gatacagtgaccaacgttgaagaaattgcgtcgtcgattcgcttatcgcactacaacaag
caaaaggcgattacgatcaccgccaacttatcggatggttacacgctgggtgatgcgttg
gattttcttgatcagcaagcgatcgagacgctgccgggcgacattaccatcagctactct
ggtgaatcgaaggacttcaaagaaaaccagtctagcgttgccattgtgtttgcgttggcc
ttgctggtggcttacctcgttcttgctgcgcagtttgaaagcttcatcaaccctctggtg
gtgatgtttaccgtgccgatgggggtgtttgggggtttcttaggcttgctcatcatgcag
caaggtatgaacatctacagtcagatcggcatgatcatgctgatcggtatggtgaccaaa
aacggtatcttgattgttgagtttgctaaccaactgcgtgaccgtggctttgagtttgaa
caagccattattgatgcctcggcacgacggttgcgcccgattttaatgaccgccttcacg
accctagcgggcgcgattccacttattctgtcggatggggcgggctacgaaagccgcgtg
gccgttggtaccgttattttcttcggtatgggttttgccaccctcgtcactttgttcgtt
atccctgcgatgtatcgtttgatatctcgatacacagaagcgccagggcatgtggaagcg
gaactcaatcaagccctcagccatgataccaaaggccgagtgagtcacggttaa

DBGET integrated database retrieval system