KEGG   Vibrio vulnificus YJ016: VV1498Help
Entry
VV1498            CDS       T00150                                 

Definition
(GenBank) glutathione S-transferase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00350  Tyrosine metabolism
vvy00643  Styrene degradation
vvy01100  Metabolic pathways
vvy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VV1498
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    VV1498
Enzymes [BR:vvy01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     VV1498
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: BAC94262
UniProt: Q7MLC9
Position
I:1532046..1532714
Genome map
AA seq 222 aa AA seqDB search
METSLKLYGYWRSSAAYRVRICLNLKQLRYENYSIHLVKNGGEQHLAHYHALNPNELVPV
LVDGDLVLNQSLAIIQYLDDNYSSTQVIPSMGPLKYQALALAQDIAIDVHPLNNLRVLQY
LEGSLEVDEEQKRLWVHHWINTGFKAVEEKLMAHRKHYGECVFSVSSSPSIVDICLVPQV
YNALRFGVNMAPYPTINAVVAACNQLPAFDLAKPENQPDAQL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atggagacaagtcttaaactctatggttattggcgttcgtctgccgcctatcgcgtgagg
atctgcttaaacctgaagcagctccgctatgaaaactactcgattcatttagtgaaaaat
ggcggagagcagcatctcgcgcattaccatgctctgaaccccaatgagctggtgcccgtg
ttggtggatggggatctggtactcaatcagtcgttggctatcattcagtatctcgatgat
aactattcatcgacgcaagtgatcccgtctatggggccactcaagtatcaagcgttggcg
ttggcgcaagacatcgcgattgatgttcatcctctgaataatcttcgggtcctgcagtat
cttgaaggcagcttggaggtggatgaagagcaaaaacgcttgtgggtgcatcactggatc
aacacaggctttaaagcggtggaagaaaaactcatggctcaccgtaaacactatggcgag
tgtgtttttagcgtcagttctagtccaagtatcgtcgatatatgtttggtccctcaggtg
tataacgcgctccgttttggcgtaaacatggcaccgtatcccaccatcaatgccgtcgtt
gccgcttgcaatcaactgcccgcattcgatctcgccaaacccgaaaatcagcctgacgct
caactttga

DBGET integrated database retrieval system