KEGG   Vibrio vulnificus YJ016: VV1605Help
Entry
VV1605            CDS       T00150                                 

Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00030  Pentose phosphate pathway
vvy00480  Glutathione metabolism
vvy01100  Metabolic pathways
vvy01110  Biosynthesis of secondary metabolites
vvy01120  Microbial metabolism in diverse environments
vvy01130  Biosynthesis of antibiotics
vvy01200  Carbon metabolism
Module
vvy_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
vvy_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
vvy_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VV1605
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VV1605
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvy04147]
    VV1605
Enzymes [BR:vvy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     VV1605
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     VV1605
Exosome [BR:vvy04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VV1605
  Exosomal proteins of colorectal cancer cells
   VV1605
  Exosomal proteins of bladder cancer cells
   VV1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: BAC94369
UniProt: Q7ML22
Position
I:1650475..1652055
Genome map
AA seq 526 aa AA seqDB search
MSLIGWAHPLSRIQAHNKYLVFKGKMMVIPENSSIVIFGASGDLTYRKLIPALYHLYASK
QLPENFAILGVSRTEYSDESYREKLKRSLQEMEKTEPAILDSFIDHLHYQAINTSDTQDY
AKLVVRLDELAAQYQFEQRNTLFYLATPPSLYSVIPSSLAHHGLNSEEDGWKRLIIEKPF
GYDLASARQLDKEIHDCFQEHQIYRIDHYLGKETVQNLLVFRFSNAMFEPLWNRNFIDYV
EITGAEFLGVEERGGYYDGSGAVRDMFQNHLLQVLAMVGMEPPAQINADSMRDEVVKVLQ
CLKPLEEDDLRNNLVLGQYTASDVRGQHLLGYREENGVADDSRTETYIGLKAYINNWRWN
GVPFYVRTGKRLPTRVTEVVIHFKQTPHPVFGQNAPENKLIIRIQPDEGIQMSFGLKEPG
AGFKAKEVKMNFHYASLQETQMLTAYERLLLDALNGDATLFARSDAVEACWKYVQPILDF
KQDPQALFGYACGTWGPKESDDLLQRDDRAWRFPCKNLTDTDYCEL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgtcactgatagggtgggctcatcctttaagccgtatccaggcacacaacaagtacctc
gtttttaagggaaagatgatggtaataccagaaaacagcagcatcgtaatttttggtgct
tcaggtgatttaacatatcgcaagttgatccctgctttataccacctctacgcaagtaag
cagctaccagaaaactttgctattttaggtgtcagccgcactgaatacagcgatgaatct
tatcgcgaaaagttaaagcgctctcttcaggaaatggagaaaacggaaccagctattctg
gattcatttatcgaccatcttcactatcaagccatcaacacgtcagacacacaagactac
gcgaagttggttgtacgtttagacgaattggccgctcaataccagttcgaacaacgtaat
acactgttttatcttgccacaccgccaagcctttacagtgtcattccttcaagccttgct
catcacggtcttaacagtgaagaggatggttggaaacggctgatcattgaaaaaccgttt
ggttatgatttggcttcggcacgtcagctcgacaaagaaatacacgattgcttccaagag
catcagatctatcgcatcgaccactaccttggaaaagagaccgtgcaaaacttacttgtt
ttccgtttctctaacgccatgtttgaacctctgtggaaccgcaacttcattgattatgtg
gaaatcacaggtgccgaattccttggcgtggaagagcgtggcggttattacgacggctcc
ggcgctgtgcgcgatatgttccaaaaccatctactgcaagtattggcaatggtgggcatg
gaaccgcctgcacaaattaatgccgattccatgcgtgatgaagtagtgaaagttctgcag
tgtttaaaaccgcttgaggaagatgatctgcgtaacaacctagttttgggtcaatacaca
gcatcagacgtgcgcggacaacatctgcttggctaccgtgaagaaaacggcgtagcggac
gattctcgtactgagacttacattggtcttaaagcgtacatcaataactggcgttggaat
ggcgtgccattctacgtgcgcacgggtaagcgtcttccaactcgcgtaacagaagtggtt
atccacttcaaacaaacaccgcatccggtatttggccaaaacgccccagaaaacaaactg
atcattcgtattcagcctgatgaaggcattcaaatgagcttcggtttgaaagaacctggt
gcaggctttaaagcgaaagaagtgaagatgaacttccattatgcttcgttgcaagagacg
caaatgctgaccgcctatgagcgtctgcttcttgatgcgttaaacggcgatgcaacgctg
tttgctcgcagcgatgcggtcgaagcgtgttggaaatacgttcaacctatcctcgatttc
aaacaagatccacaagcactctttggttatgcctgcggcacttgggggccaaaagagtca
gacgatttgctgcagcgtgacgatcgcgcgtggcgtttcccatgcaaaaacctaacagat
acggactactgcgaactatga

DBGET integrated database retrieval system