KEGG   Vibrio vulnificus YJ016: VV1711Help
Entry
VV1711            CDS       T00150                                 

Definition
(GenBank) signal transduction histidine kinase
  KO
K02482  two-component system, NtrC family, sensor kinase [EC:2.7.13.3]
Organism
vvy  Vibrio vulnificus YJ016
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvy01001]
    VV1711
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vvy02022]
    VV1711
Enzymes [BR:vvy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VV1711
Protein kinases [BR:vvy01001]
 Histidine kinases
  NtrC family
   VV1711
Two-component system [BR:vvy02022]
 NtrC family
  Unclassified
   VV1711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_3 HATPase_c Cache_3-Cache_2 HisKA sCache_3_2 HAMP HA Atg14 DASH_Dad3 Gp-FAR-1 Exonuc_VII_L dCache_3 ECM11
Motif
Other DBs
NCBI-ProteinID: BAC94475
UniProt: Q7MKR7
Position
I:complement(1766100..1768226)
Genome map
AA seq 708 aa AA seqDB search
MAINRRHRVILAWHAKRWSANTKSGKPRKRIMQSDQTLWSTWRYRFKSMVRYRLLFLTSA
PIFLTLIALIGISVYWSIHYTWSSALIDVSERLGVANNSITLLQQKQANYVKAFAESYQF
RTRINQPMDQDDLQQWVHKQKKQYQLDFLAFHRVDTIEQKFRFLDLTKRESFFDVLSETE
LQRLDPDLAKRAEVPILKTGKIETRGLISRTVIPVFNQSNDLIGFLDGGLLLNNSTVLVD
QIRDLIYIGDEDSLRPIGTVTLFMEDLRVSTNVPLDSEDQIGRAIGTRVSGEVHKSVLQQ
GERWVNRAFVYDAWYITAYQPIRDQYNNTIGMLYTGYLMWPFVKAYLTNIVEISVITLTL
LVVSGLLVYRGSRDLFRPIERIHKVVKLVQLGKDKRIGALGLDENHELAQLAKQFDNMLD
LLKTREQQIKQAANELEQKVLERTASLNEKTEQLEHHIRLLNQTRDKLIVNEKLAALGEL
TAGIAHEINNPTAVILGNVELIRFELGEDAARVEEEIETVMAQIDRIRNITRSLLQYSRQ
GGVQDEIIWQHVNPIIEESITLVKTGSKKRTIEFVTELNAHTSVEVNRHQLLQILVNLQM
NAIHAMNGEGRLTITSEDWLEEGESVGAVIHIEDQGCGIKPEKLSRIFDPFYTTKRDGTG
LGLSVSQSLLSQSGGEIKVRSQLGIGSTFSVYLPRKNEAKLRDTLLIQ
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atggcaataaatcggcggcatcgcgtgatcttggcgtggcacgcaaaacgttggagcgca
aatacaaagagtgggaaaccgaggaagcggattatgcagagtgatcaaacactttggtca
acttggcgctatcgctttaaaagtatggtgcgctatcggttgctgtttctaacctcagcg
ccgattttcctcaccttgattgcacttattggcatctctgtctattggtcgatccattac
acttggagcagtgcactgattgatgtttctgaacgccttggggttgccaataacagcatt
acgctattgcaacagaagcaggctaattacgttaaagcctttgctgaaagctatcagttt
cgcactcgtatcaatcagccaatggatcaagacgatcttcagcaatgggtacacaaacag
aaaaagcaatatcagctcgattttctcgcttttcatcgtgtcgacaccatagagcaaaaa
tttcgttttctcgatttaaccaaacgagaatccttttttgatgtgttgagcgaaacggag
ttacaacgccttgatccagacttggccaaacgcgccgaagtgccgattttaaaaacgggc
aaaattgaaacgcgtggcctcatcagccgcactgtgattccagtgtttaaccaaagtaat
gatctgattggttttctagatggcgggttactacttaacaacagcaccgtgctcgtcgac
caaatccgcgacttgatttacatcggagatgaggattctctcaggccgatcggtaccgtg
acgctgtttatggaagatctccgcgtcagcaccaatgtaccactagacagcgaagatcag
attggccgtgcgatcggtactcgggtttctggtgaagtgcataaatcggtattgcagcaa
ggagagcgttgggttaatcgcgcctttgtgtatgacgcttggtatatcaccgcctatcaa
cccattcgcgaccaatacaacaacaccatcggcatgctctacaccggctatttgatgtgg
ccatttgttaaagcgtatcttaccaacatagtggaaatcagcgttattaccttaaccttg
ctggtggtctctgggcttttggtttatagaggctcgcgggatcttttccgtcctattgaa
cgcattcataaagtggtgaaattggtgcaactgggcaaagacaagcggattggtgcgtta
gggctagatgaaaaccacgagctggcgcaattggccaaacagtttgacaacatgctcgat
ctgctcaaaacgcgtgaacagcagatcaaacaagcggccaatgaactggagcaaaaagtg
ttggaacgcacagccagcctcaatgagaaaaccgagcagctcgaacaccacattcgatta
ctcaatcaaacgcgcgacaaactgatcgtcaatgaaaagctggcggccttgggcgagtta
accgccggtatcgcccatgagattaacaacccaaccgccgtgatactgggcaacgtcgag
ttgattcgttttgaactcggtgaggatgccgcacgcgtagaggaagagatagaaacggtg
atggcgcagattgaccgtattcgaaacatcacgcgaagtttgctgcaatacagccggcag
ggcggggtgcaggacgaaatcatctggcagcacgtcaatccgatcatcgaagagagcatt
acgttggtgaaaaccggctctaaaaaacgcaccatcgagttcgtcactgagctcaatgcg
catacatcggttgaagtgaatcgccatcaactgttacagattttggttaacttacaaatg
aatgccatccatgcaatgaacggcgagggccgattgaccatcaccagtgaagattggttg
gaagaaggggaaagcgttggggcggtgatccacattgaagatcaaggttgcggcattaag
cccgaaaaactgagccgaatatttgacccgttttacaccactaaacgtgatggaaccggc
cttggtctttctgttagtcagagtttgcttagccaatcaggcggggagatcaaagtgcgt
tcacaactggggattggcagcacgtttagcgtttacctcccaagaaagaacgaagccaaa
ctgcgtgacaccttactgattcaatag

DBGET integrated database retrieval system