KEGG   Vibrio vulnificus YJ016: VV2879Help
Entry
VV2879            CDS       T00150                                 

Definition
(GenBank) xanthosine triphosphate pyrophosphatase
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    VV2879
Enzymes [BR:vvy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     VV2879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like LytR_C
Motif
Other DBs
NCBI-ProteinID: BAC95643
UniProt: Q7MHJ0
Position
I:2930985..2931665
Genome map
AA seq 226 aa AA seqDB search
MSTRASKAQASSNLPKSFMLKNNENTMKKIVLATGNQGKVREMADLLADFGFDVVAQSEF
NVSEVAETGTTFIENAIIKARHAAKETGLAAIADDSGLEVDFLQGAPGIYSARYAGEKAS
DQENLEKLLTAMEGVPEAQRTARFHCVLVLMRHENDPTPIVCHGKWEGRILTQAHGDNGF
GYDPIFFVPEDNCASAELEPVRKKQLSHRGKALKQLFATLREQPLV
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgcgggcatcaaaggcgcaggcaagctcaaatttacccaaaagttttatgttg
aagaataacgagaacaccatgaaaaagatcgtattagccacaggtaaccaaggcaaagtt
cgcgaaatggcagacctacttgccgatttcggttttgatgtcgtcgcacaaagcgaattc
aatgtgtctgaagtggctgaaacgggcacaactttcattgaaaatgccatcatcaaggcg
cgtcacgccgctaaagagaccgggcttgcagcgattgcggatgattcaggtttagaagtg
gattttcttcagggcgctcctgggatttactctgcacgttacgcaggagagaaagcctca
gatcaagaaaacttagaaaagctattaacagcgatggaaggtgtgccagaagcacaacgt
accgcgcgtttccattgtgtgttggtgttgatgcgccacgaaaacgacccgacacccatt
gtctgccacggcaaatgggaaggccgcatcttaacacaagcacacggtgacaacggcttt
ggctacgatccaatcttcttcgtcccagaagacaactgcgcatctgccgagcttgaacct
gtgcgcaagaaacaactctctcatcgtggtaaagcattgaaacagctttttgctacgcta
cgtgaacaacctttagtgtaa

DBGET integrated database retrieval system