KEGG   Vibrio vulnificus YJ016: VVA0722Help
Entry
VVA0722           CDS       T00150                                 

Definition
(GenBank) formyltetrahydrofolate synthetase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy00670  One carbon pool by folate
vvy01100  Metabolic pathways
vvy01120  Microbial metabolism in diverse environments
vvy01200  Carbon metabolism
Module
vvy_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    VVA0722
Enzymes [BR:vvy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     VVA0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS
Motif
Other DBs
NCBI-ProteinID: BAC96748
UniProt: Q7MEE8
Position
II:complement(821817..823565)
Genome map
AA seq 582 aa AA seqDB search
MLSDIDICRTTPLKPIEQIAAKAGLLADEFETHGLYKAKVSARCVKRLAEQQDGKLVLVT
AITPTPLGEGKTVTTIGLAQGLQSLNQSVMACIRQPSMGPVFGVKGGAAGGGYSQVAPMD
ELNLHLTGDIHAVTAAHNLAAAAIDARIYHEQRAGYQAFEARTGLPALRIDPDRVVWKRV
MDHNDRALRKVRVGLNDEGKTINGFEREEGFDISAASELMAILALSKNLQDMRERIGKVV
LAYNLDGEPVSAEQLQVAGAMTVTLKEAIKPTLMQTLEGVPTLIHAGPFANIAHGNSSII
ADEIALKLSSYVVTEAGFGSDMGLEKACNIKSSTSHKAPDCVVIVATLRGLKANSGLYDL
KPGMPLPDALFQPDRAALESGFSNLKWHIDNAQKYGLPAVVAINQFPQDSAEELGQLKLW
IQQLPLNVRVAISEGFAKGGKGMEAVAREVIEACDAPANFRPLYRAEQTLEEKIITVCTK
GYGCGEVQFSDTAKQQLALYQTLGFGELAVCMAKTPLSISSDSSLKGAPSGFTIMVREVR
LCAGAGFVYALTGNVMTMPGLPDIPAFMALDIDENGDIVGLS
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgctttcagatatcgatatttgtcgtacgacacctcttaaaccaattgaacagattgcc
gcaaaagcaggactgctggcagatgagtttgaaactcacggtttatataaagcgaaagtg
tctgcccgatgtgtaaaacgccttgctgagcaacaagatggcaaacttgttttggttacg
gcaatcacaccaaccccacttggagaaggtaaaaccgtcaccactatcggtctagcacaa
gggttacagagcctcaatcaatcggtgatggcgtgtatccgtcaaccttctatggggcct
gtttttggtgtcaaagggggcgctgcgggtggtggctattcacaggtcgccccgatggat
gaacttaatttgcatcttactggcgacattcacgccgttactgcggcgcacaatcttgcc
gcggccgccattgatgcccgcatctaccacgaacagcgtgctggttatcaagcctttgaa
gctcgcactgggctccctgcattaagaattgacccagatcgcgtggtttggaaacgcgta
atggaccataacgatcgcgcactgcgtaaagttcgcgttggactcaatgacgaaggcaaa
accatcaatggatttgaacgtgaagaaggctttgatatttcagccgcatctgaactgatg
gcaattttggcgttgtcgaaaaaccttcaagatatgcgtgaacgtattggtaaagtggtt
ctcgcttacaatctggatggcgagcctgtcagtgcagaacagttacaagtggcaggagcg
atgacagtaacgctgaaagaagcgatcaaaccgacactgatgcaaacgcttgaaggtgta
cctacccttattcatgcgggtccatttgccaacattgcgcacgggaactcatccatcatc
gctgatgagattgccttaaaattgtcgagttacgttgtcaccgaggccggttttggctca
gatatggggcttgaaaaagcatgcaacatcaaatcttcaacttcgcacaaagcccccgat
tgcgtggtgattgttgcgactttgcgcggtttgaaagcaaactcagggctgtatgaccta
aaacctggtatgccattaccagacgccttatttcaaccggatcgcgcagcgctggaatcc
ggctttagtaacctaaaatggcatattgataacgcgcaaaaatacggtttaccagcggtc
gttgctatcaatcagtttccgcaagacagcgcagaggagctcgggcaactcaagctttgg
attcagcaactgccactcaatgttcgtgtcgcgatcagtgagggctttgccaaaggtggt
aaaggcatggaggcggtagctcgtgaagtgattgaagcatgtgatgcgccagcaaacttt
cgcccactgtatcgagcagagcaaacgctcgaggagaaaatcatcaccgtttgtactaaa
ggttacggttgtggtgaggtgcaatttagcgataccgcaaaacagcagttagctctttat
caaacattaggatttggcgagttggccgtgtgtatggcaaaaacccccctttctatctcg
tccgattcctctctcaaaggtgcaccaagtggatttaccatcatggtccgtgaagttagg
ctctgtgctggcgcgggcttcgtttacgcgctcactggcaatgtgatgacgatgccaggt
ctgccagacatccccgcttttatggcattggatatcgatgaaaatggcgatattgttggc
ctaagctaa

DBGET integrated database retrieval system