KEGG   Vibrio vulnificus YJ016: VVA0978Help
Entry
VVA0978           CDS       T00150                                 

Definition
(GenBank) uncharacterized protein conserved in bacteria
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vvy  Vibrio vulnificus YJ016
Pathway
vvy03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vvy00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VVA0978
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vvy02044]
    VVA0978
Secretion system [BR:vvy02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VVA0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V MspA
Motif
Other DBs
NCBI-ProteinID: BAC97004
UniProt: Q7MDQ8
Position
II:complement(1086740..1088575)
Genome map
AA seq 611 aa AA seqDB search
MKKATQDNKFINISTPYGKDAIILNSFEYREEMSELFSLRVYAYFNGQKGELNQIMGQPV
IIKMDNNSQVMLEPRYFHGFVAKATLAGSRVTKFEDGENYKNIELVVVPKLNFADYKINS
RIFQNKDIKEIISLILGEHGVDFSFSLTKSYAKYNYKVQYEESDLQFVKRLLSEEGLSFC
FSHTKSSHVIEIFDDASYYKPGAEFLIDFNSGTAELGHISSWHEAQSMVIMRSHKSGYDM
KKPASHPNNTAKGSESLFTVPSSEHYEYLGEAESGDQYKTRNTHTIESLQQNAYVCSGES
SCRSFTVGRSFKFGKHEDPSRIGKEFVLSSIVINAAVFNQVGHGGPSNQGVRSYFTCIES
GKVHRPAVNFVRPVIRGIQTAVVTGNKQGEIYVDKYGRIKVQFHWDREGKFDTTSSCWIR
VAQQIAGNGWGSSFLPRVGQEVIVEFINGDPDQPVVTGSLYNGTQAPPFSLPEKKTQSGY
RSQSVEKGASNYNELRFEDKPGEEHVYLHAEKNFQMVVEDSADVLVENNKTQKITNNLTE
EVGQNVSGKIGKNYSLDIGEVLSLTAGKSIEIKVGGASIQMSSSGEINIKGNKIAINGAS
IALKAGQISLN
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagcgactcaagataataaatttataaatatttccacgccttatgggaaagat
gcgattattctcaattcttttgaatatagagaagaaatgtcagagctattttcattgcga
gtttatgcttattttaatggtcaaaaaggcgaattgaatcaaatcatgggtcagccagtt
attatcaaaatggataataatagccaagtcatgttggaaccgagatacttccatggattt
gttgcaaaggcaacactagcaggaagccgagtgaccaaatttgaagatggtgaaaactac
aaaaacattgagcttgttgttgtgccaaaattgaattttgcggactacaaaatcaacagc
cgaatctttcaaaataaagatataaaagaaattatttcattaattcttggtgagcatggc
gtcgacttttctttttctctgaccaaaagctatgccaagtataactacaaagttcagtac
gaagaatcggatctacagtttgttaaaagactcttatctgaggaagggctgtcgttctgt
ttcagccatactaaatcttcacatgtgatcgagatatttgatgatgccagctattacaag
ccaggtgctgaatttttaattgatttcaattcaggtaccgcagagttgggtcatatctct
tcgtggcatgaagctcaatcgatggtgatcatgcgcagtcacaaaagtggctatgatatg
aaaaagccagcttcacatcccaacaatacggcaaaagggagcgaatccttatttaccgtt
ccgagtagcgagcattatgaatatctgggtgaagcggagtcgggtgatcagtacaaaacg
agaaatacccacacgatcgaatcattacagcaaaacgcatacgtttgttctggagagtcg
agttgccgctcctttactgtcggcagaagtttcaaatttggtaagcatgaagaccctagc
cgaatcggcaaagagttcgtgctctcatcgattgttatcaacgcagctgttttcaaccaa
gtaggtcatggtggcccttcaaatcaaggtgttaggagttattttacctgcattgagtca
gggaaagtgcatcgtccggcggttaactttgtgaggccagttattcgcggaatccaaact
gcggttgtgacaggtaataagcaaggtgaaatctacgtcgataaatatgggcggataaaa
gttcaatttcactgggatcgtgaaggtaagtttgatacgacgagctcgtgctggatacgt
gtcgcacaacaaattgcagggaatggctggggaagctcatttctgccaagagtagggcaa
gaggtcatcgttgaatttatcaatggggatccggatcagccagtggtgacagggtcgctt
tacaatgggactcaagcgccacctttttcgttgccagagaagaaaacccaaagtggttac
cgtagccagtctgtagaaaaaggggcgagtaactacaacgaattacgctttgaagacaaa
ccgggtgaggaacatgtctatcttcatgcggaaaagaacttccaaatggtcgtcgaagat
tccgctgatgtcctagttgaaaacaataagacccagaaaattaccaacaacctaacggag
gaggttggacaaaacgtctctgggaagattgggaaaaactattcactcgatattggcgaa
gtcctttctctgaccgcaggcaaaagcattgaaattaaagtgggcggcgcttcgattcag
atgtcgagttcgggggagatcaatattaaaggcaacaaaatagccattaatggtgcctcg
attgccttaaaagctggccagatttcactgaactag

DBGET integrated database retrieval system